(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE134

ASPNC_1.PE134        Location/Qualifiers
FT   CDS             join(342903..342937,343262..345536)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875724"
FT                   /orf_name="An01g01450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43517.1"
FT                   /db_xref="UniParc:UPI0000EF9DE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P4"
FT                   /transl_table=1
FT                   /translation="MDRGFESQRGRWSVVSRLLHSSYWPTILDSDTAASTGVSKRILTY
FT                   SWLQLIAAVLVSITGIVTPLGLYDTIGPQDNPTDVLFHYAPDTSAFGKATPSRDGYKSL
FT                   RICYADEDPDTPEGCPGAPPNRADMEDITEAYSVWPSSVSLFTSGNVSATVSSVFDVQW
FT                   RSFRSSTQIVPGASATGSVFSQGYYRQISQLILDEDLLAVEGLIVDSKAGRIGFRNHTI
FT                   PSTLPMGAEWTEDILFIEPETRCVDTNLTVDYNYDPQAQYSSYSTDDIYNTDLRNLALV
FT                   DRGGFVNLSHERYSIDASNFQEDAALYERAYNAAWRHNMLIMQYFNVTTNGSDGRAPFA
FT                   YMHSEMGKRFSLANMSSIIVEPMTVQTDSGYGSFLDVPDGFTLSGNFSSGQPENPLNLS
FT                   TYDVYAIGSEACHYPSDKALSNMSFVGVACGTVFAAPRRLDGDSLIPDTNSTWSTPLYS
FT                   CAAATKAAVREVTFRFNGTGGLDKLVIQSINEKKYKDPSELPLWGVERLKNHTLQNVRP
FT                   LWGLVSPEVGARDDISTVQRDYLWLPGYADLLTSDTIAGEPSMPGNLFYTQRLLSLFDI
FT                   ATLNQATSRYTGSGDLALYNRWFELSSSASGVEKMLGLIWTDMTANTVVGTRGWHNAPS
FT                   QTSKNSKRMSKRDVGGVSVPVTLWSRNIKYHIPYAIPAFIVLALSIALAGFTICLLILR
FT                   RTGLGQMRSYLARTSPGRILGSALHPDQAGVLASTKTWIQQVGVRKATLPGQKEDGTIP
FT                   LLDIPAAGEEGVRDRK"
     MDRGFESQRG RWSVVSRLLH SSYWPTILDS DTAASTGVSK RILTYSWLQL IAAVLVSITG        60
     IVTPLGLYDT IGPQDNPTDV LFHYAPDTSA FGKATPSRDG YKSLRICYAD EDPDTPEGCP       120
     GAPPNRADME DITEAYSVWP SSVSLFTSGN VSATVSSVFD VQWRSFRSST QIVPGASATG       180
     SVFSQGYYRQ ISQLILDEDL LAVEGLIVDS KAGRIGFRNH TIPSTLPMGA EWTEDILFIE       240
     PETRCVDTNL TVDYNYDPQA QYSSYSTDDI YNTDLRNLAL VDRGGFVNLS HERYSIDASN       300
     FQEDAALYER AYNAAWRHNM LIMQYFNVTT NGSDGRAPFA YMHSEMGKRF SLANMSSIIV       360
     EPMTVQTDSG YGSFLDVPDG FTLSGNFSSG QPENPLNLST YDVYAIGSEA CHYPSDKALS       420
     NMSFVGVACG TVFAAPRRLD GDSLIPDTNS TWSTPLYSCA AATKAAVREV TFRFNGTGGL       480
     DKLVIQSINE KKYKDPSELP LWGVERLKNH TLQNVRPLWG LVSPEVGARD DISTVQRDYL       540
     WLPGYADLLT SDTIAGEPSM PGNLFYTQRL LSLFDIATLN QATSRYTGSG DLALYNRWFE       600
     LSSSASGVEK MLGLIWTDMT ANTVVGTRGW HNAPSQTSKN SKRMSKRDVG GVSVPVTLWS       660
     RNIKYHIPYA IPAFIVLALS IALAGFTICL LILRRTGLGQ MRSYLARTSP GRILGSALHP       720
     DQAGVLASTK TWIQQVGVRK ATLPGQKEDG TIPLLDIPAA GEEGVRDRK                   769
//

If you have problems or comments...

PBIL Back to PBIL home page