(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE135

ASPNC_1.PE135        Location/Qualifiers
FT   CDS             join(347298..347415,347473..347657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875725"
FT                   /orf_name="An01g01460"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01410 - Aspergillus niger"
FT                   /protein_id="CAK43518.1"
FT                   /db_xref="HOGENOM:HBG331372"
FT                   /db_xref="UniParc:UPI0000EF9DEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P5"
FT                   /transl_table=1
FT                   /translation="MKLTTTAFGTFALIAAANAAVTGHCTPGLNYCSRVLEDVGGNHAA
FT                   IADGLTRDGYTSAAQYPVMWNEFLFHCNNDQSISVVGACYGSCRNNGSGQSDTCA"
     MKLTTTAFGT FALIAAANAA VTGHCTPGLN YCSRVLEDVG GNHAAIADGL TRDGYTSAAQ        60
     YPVMWNEFLF HCNNDQSISV VGACYGSCRN NGSGQSDTCA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page