(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE137

ASPNC_1.PE137        Location/Qualifiers
FT   CDS             350219..350719
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959663"
FT                   /orf_name="An01g01475"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43520.1"
FT                   /db_xref="HOGENOM:HBG329708"
FT                   /db_xref="UniParc:UPI0000EF9DEC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P7"
FT                   /transl_table=1
FT                   /translation="MASGLILNPHNLLRAAPLVSSTCTLWFAFDQDLVLNVFLHPDHRP
FT                   RSNEILPSYFNVLFRRGVVRVVGLLALSMAGGGYNILKDRRSGVVAGLQSSLSWYVAGT
FT                   VLAASHLLYVPVIAPKVLAIMEDSSKGSSTEDLEGWLTIHRVRTWTVDFAAWACFVVGL
FT                   GLA"
     MASGLILNPH NLLRAAPLVS STCTLWFAFD QDLVLNVFLH PDHRPRSNEI LPSYFNVLFR        60
     RGVVRVVGLL ALSMAGGGYN ILKDRRSGVV AGLQSSLSWY VAGTVLAASH LLYVPVIAPK       120
     VLAIMEDSSK GSSTEDLEGW LTIHRVRTWT VDFAAWACFV VGLGLA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page