(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE142

ASPNC_1.PE142        Location/Qualifiers
FT   CDS             join(358901..359496,359589..360402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875729"
FT                   /orf_name="An01g01530"
FT                   /product="Catalytic activity: proline dehydrogenases
FT                   convert L-proline + acceptor + H(2)O to "
FT                   /EC_number="1.5.99.8"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAK43525.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326213"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI0000EF9DF1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q2"
FT                   /transl_table=1
FT                   /translation="MRSKVLLWPKRPTPLLYYQLLHHPPVYYHAYYNTSSTSTTTTHHT
FT                   VPPPAPKTPSPAPLSALPTRTFLRSLLFTSVMASPLLKPCLSLLKYMVDSNSLLFSPAK
FT                   NPVVNYLLRRTIYDHFCAGINEREVRNTVQEMKSLGFKGVILGYARESIAKVEDVDRIQ
FT                   SAEEKQEALDRAVEEWRVGTLRTLGMCGRGNYLAVKFTGAGPAAVEALSRGDRVPPPRI
FT                   QEAMMEICDAVAAQGSRVWIDAEQQIFQGAIDAWAVDLMRKYNRVNRADAPVVLNTYQA
FT                   YLKSSTARLNEHLQLAQREGWAMGVKLVRGAYIAHDHRDRIHDTKADTDRNYDHIVESL
FT                   ITRQYPLGGEPGQPFPKVRLFVASHNGVSVRKACALYRQRAQSGLPLIPVEVGQLQGMA
FT                   DEVSLGMVEGSTDGAAPGVFKCLAWGSTEECLHFLLRRAVENQSAMERTRDTARALRGE
FT                   AWRRLGGGSVM"
     MRSKVLLWPK RPTPLLYYQL LHHPPVYYHA YYNTSSTSTT TTHHTVPPPA PKTPSPAPLS        60
     ALPTRTFLRS LLFTSVMASP LLKPCLSLLK YMVDSNSLLF SPAKNPVVNY LLRRTIYDHF       120
     CAGINEREVR NTVQEMKSLG FKGVILGYAR ESIAKVEDVD RIQSAEEKQE ALDRAVEEWR       180
     VGTLRTLGMC GRGNYLAVKF TGAGPAAVEA LSRGDRVPPP RIQEAMMEIC DAVAAQGSRV       240
     WIDAEQQIFQ GAIDAWAVDL MRKYNRVNRA DAPVVLNTYQ AYLKSSTARL NEHLQLAQRE       300
     GWAMGVKLVR GAYIAHDHRD RIHDTKADTD RNYDHIVESL ITRQYPLGGE PGQPFPKVRL       360
     FVASHNGVSV RKACALYRQR AQSGLPLIPV EVGQLQGMAD EVSLGMVEGS TDGAAPGVFK       420
     CLAWGSTEEC LHFLLRRAVE NQSAMERTRD TARALRGEAW RRLGGGSVM                   469
//

If you have problems or comments...

PBIL Back to PBIL home page