(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE145

ASPNC_1.PE145        Location/Qualifiers
FT   CDS             join(complement(369880..370325),complement(369249..369815),
FT                   complement(369001..369082))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875731"
FT                   /orf_name="An01g01560"
FT                   /product="Similarity to hypothetical protein yxaG -Bacillus
FT                   subtilis"
FT                   /protein_id="CAK43528.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0000EF9E01"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q5"
FT                   /transl_table=1
FT                   /translation="MRSFVFSSLLALTSALSVEDLYVSEAPSSPRPYILPHYENSHAVT
FT                   IDSQLYRFTVTGPSSDYAFTLMSTNAPSSSSLGVLPHIHRTHYENFFSFKGRFQLWAQK
FT                   GDGEQEARLLTQGDYGSVPRNTTHTFQILDPDTEMVGVIVPGGFEDLFYALGTNYTSGT
FT                   ETPYVPGSGNSSSSSATGPDSSTISGLQQYDVYAQLDFTPRRDIVNGSAPSDSGWHTES
FT                   DTLGAAGKPYFIANNYGPKYLNSQYGAYQIVQPLVTATQAQDTNYTLSTIIMSRQPSNA
FT                   TAPTWTAGPAAFEVLEGSVQVQIGEYETARVEMGDVVFVPKGVTYRYWNEGAQAKVLYW
FT                   RRVGVMEIQHVAGPRIPGCGGGLG"
     MRSFVFSSLL ALTSALSVED LYVSEAPSSP RPYILPHYEN SHAVTIDSQL YRFTVTGPSS        60
     DYAFTLMSTN APSSSSLGVL PHIHRTHYEN FFSFKGRFQL WAQKGDGEQE ARLLTQGDYG       120
     SVPRNTTHTF QILDPDTEMV GVIVPGGFED LFYALGTNYT SGTETPYVPG SGNSSSSSAT       180
     GPDSSTISGL QQYDVYAQLD FTPRRDIVNG SAPSDSGWHT ESDTLGAAGK PYFIANNYGP       240
     KYLNSQYGAY QIVQPLVTAT QAQDTNYTLS TIIMSRQPSN ATAPTWTAGP AAFEVLEGSV       300
     QVQIGEYETA RVEMGDVVFV PKGVTYRYWN EGAQAKVLYW RRVGVMEIQH VAGPRIPGCG       360
     GGLG                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page