(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE146

ASPNC_1.PE146        Location/Qualifiers
FT   CDS             join(complement(373209..373609),complement(372498..373151),
FT                   complement(372140..372431))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110563"
FT                   /orf_name="An01g01580"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g00420 - Aspergillus niger"
FT                   /protein_id="CAK43529.1"
FT                   /db_xref="UniParc:UPI0000EF9E02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q6"
FT                   /transl_table=1
FT                   /translation="MNTPGTVYTPDPMDIDESMDSASSTTSSDPMDLAPLTETTQSRAV
FT                   SEIGLQPSLRPGGPDAGLTSHLRAQRYKELYPEGTPRWTKEAIQEAQARVERCKPGEVV
FT                   YTTALDGANVDFEVMTERIERNKQGVAIVGLKHFLEFFPAPTDYITPNPGTRHPSLIYS
FT                   NLALGHKFRRLDEEDTDDEDEDPTDKQIAAAHESFNSIFHAWTDSAIYKNMLATLRNLP
FT                   TIKRPVTKIIAFGCNSLCSPKLDKFARERSAYQHAFLLMLRRVLQEMAWTPTDIEILLQ
FT                   DPAYTKLDKKVLGDCGMTVLDSPKAFLLVDDESFVFSCSPDVPVRQIVMDLASPVGMIW
FT                   DAVVAESMSLDTKDPWDITIHRKINQNYNTYNLPKDKRFSMLKIYLRCSDGELSDTECE
FT                   RREEKMRNTMDFVQRNKFLVSWEKDKVQDVYSVYRRMRGSHGSDGSGRN"
     MNTPGTVYTP DPMDIDESMD SASSTTSSDP MDLAPLTETT QSRAVSEIGL QPSLRPGGPD        60
     AGLTSHLRAQ RYKELYPEGT PRWTKEAIQE AQARVERCKP GEVVYTTALD GANVDFEVMT       120
     ERIERNKQGV AIVGLKHFLE FFPAPTDYIT PNPGTRHPSL IYSNLALGHK FRRLDEEDTD       180
     DEDEDPTDKQ IAAAHESFNS IFHAWTDSAI YKNMLATLRN LPTIKRPVTK IIAFGCNSLC       240
     SPKLDKFARE RSAYQHAFLL MLRRVLQEMA WTPTDIEILL QDPAYTKLDK KVLGDCGMTV       300
     LDSPKAFLLV DDESFVFSCS PDVPVRQIVM DLASPVGMIW DAVVAESMSL DTKDPWDITI       360
     HRKINQNYNT YNLPKDKRFS MLKIYLRCSD GELSDTECER REEKMRNTMD FVQRNKFLVS       420
     WEKDKVQDVY SVYRRMRGSH GSDGSGRN                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page