(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE161

ASPNC_1.PE161        Location/Qualifiers
FT   CDS             join(complement(412652..412676),complement(411539..412548))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653767"
FT                   /orf_name="An01g01730"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g06350 - Aspergillus niger"
FT                   /protein_id="CAK43544.1"
FT                   /db_xref="UniParc:UPI0000EF9E25"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S1"
FT                   /transl_table=1
FT                   /translation="MMPSRLIELQLSLLSSSIRHSTNTISTMSASPFGRFTGLPSEIRL
FT                   LIWEELVKGGSLAILRTSQAIYHDIADRLYDTFDIHLTTLLEDPWIEIRCKRLCASWVI
FT                   GRQDFLKFSDLTRVPYDKVKLVVHIYAPDPDDCGQFILLWEKISRLTRMLCHADVSRNY
FT                   YIYWCGLGYERLRHSEPSPETFISMVIRLRKHNGVDWISDGQLTSTFCTEGLGYDFNEV
FT                   LLPFCRLSRVRRFRVIPDTEEMADAADWGFVNYASAFIMSEGFVTSNDTFYSDDPEYRD
FT                   IARTFDSIEGLVDGRDDFILALDAFYLPHISGHTAALMCREHYTLLLDTMVWRKPIPEK
FT                   HYTR"
     MMPSRLIELQ LSLLSSSIRH STNTISTMSA SPFGRFTGLP SEIRLLIWEE LVKGGSLAIL        60
     RTSQAIYHDI ADRLYDTFDI HLTTLLEDPW IEIRCKRLCA SWVIGRQDFL KFSDLTRVPY       120
     DKVKLVVHIY APDPDDCGQF ILLWEKISRL TRMLCHADVS RNYYIYWCGL GYERLRHSEP       180
     SPETFISMVI RLRKHNGVDW ISDGQLTSTF CTEGLGYDFN EVLLPFCRLS RVRRFRVIPD       240
     TEEMADAADW GFVNYASAFI MSEGFVTSND TFYSDDPEYR DIARTFDSIE GLVDGRDDFI       300
     LALDAFYLPH ISGHTAALMC REHYTLLLDT MVWRKPIPEK HYTR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page