(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE165

ASPNC_1.PE165        Location/Qualifiers
FT   CDS             join(419587..419631,419954..420041,420172..420270,
FT                   420351..420423,420455..420509,420598..420687,4
FT                   21104..421358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806415"
FT                   /orf_name="An01g01770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43548.1"
FT                   /db_xref="UniParc:UPI0000EF9E29"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S5"
FT                   /transl_table=1
FT                   /translation="MSSATCQLERAGFPRNTQLEMMVPCIIPRSSQKRTPKKAKGEEDS
FT                   YRQTSYRTVYLPKQVPEGLAVKKLSNSVIRFNNIRVPLCNGYWPRKLQKVDICMIRRYR
FT                   FFSSLSTDAQKLAHTKYLGAYMAVQKTIRTPASYGRLDTASGWDCLIRNVRITIYEKST
FT                   SIKANIEVWGSGTVPRLLKKVLRARSGPPTVDCLKRLVGSRFVDVKDSSELLKVTGKTV
FT                   DRDLDMAQSSLS"
     MSSATCQLER AGFPRNTQLE MMVPCIIPRS SQKRTPKKAK GEEDSYRQTS YRTVYLPKQV        60
     PEGLAVKKLS NSVIRFNNIR VPLCNGYWPR KLQKVDICMI RRYRFFSSLS TDAQKLAHTK       120
     YLGAYMAVQK TIRTPASYGR LDTASGWDCL IRNVRITIYE KSTSIKANIE VWGSGTVPRL       180
     LKKVLRARSG PPTVDCLKRL VGSRFVDVKD SSELLKVTGK TVDRDLDMAQ SSLS             234
//

If you have problems or comments...

PBIL Back to PBIL home page