(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE17

ASPNC_1.PE17         Location/Qualifiers
FT   CDS             join(40931..40975,41097..41687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874686"
FT                   /orf_name="An01g00170"
FT                   /product="Remark: RAD52 Inhibitor "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAK36868.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG329774"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0000EF9EED"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C4"
FT                   /transl_table=1
FT                   /translation="MVRKDPIFEARTNVKLHSNRLKKEAARAEATFKSEKAKADKAMKN
FT                   REFQIARIHAASAVREKRRQVTLKAEAARADVIINELKAAQSTRDTSRTLALASRGLDA
FT                   ASKSVNLESLVSHANNFLARSEDFKIASSAIEDVAQGVSLQENGAEGEADVDRLMEQLA
FT                   DDAGVDLRMALEQDAAAAPKEEVKAPKQVDTELEDGLDARLRALRATN"
     MVRKDPIFEA RTNVKLHSNR LKKEAARAEA TFKSEKAKAD KAMKNREFQI ARIHAASAVR        60
     EKRRQVTLKA EAARADVIIN ELKAAQSTRD TSRTLALASR GLDAASKSVN LESLVSHANN       120
     FLARSEDFKI ASSAIEDVAQ GVSLQENGAE GEADVDRLME QLADDAGVDL RMALEQDAAA       180
     APKEEVKAPK QVDTELEDGL DARLRALRAT N                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page