(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE172

ASPNC_1.PE172        Location/Qualifiers
FT   CDS             439169..440611
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806416"
FT                   /orf_name="An01g01840"
FT                   /product="Catalytic activity: RCH2NH2 + H2O + O2  "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43555.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG556224"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0000EF9E30"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T2"
FT                   /transl_table=1
FT                   /translation="MALQLLSLLCLILTTAAFPVSEVDVAIIGAGLSGLSAAKDLAAAG
FT                   RSFAILEARDRVGGRVLNVELPGGIVEEVGAEFVGPTQDRVLALAAELGLTTYPTYNTG
FT                   NCTLLRNGTVTNYPCELGSGSLPPLTTEALIEVFTLQQQLNALAAEIDVETPWDHPNAS
FT                   IWDTMTLETFLASQLTLSDARFLLNTFVTGILATEANEPSLLYMLAYIAASGNETEVGT
FT                   LDRLIDVAGGAQESRIVGGTQLIALRLADRLGAENINLRSPVQRVLHCNGRYMINTNGT
FT                   QISAKRVIVAMSPPMAARISYDPPLPPARDQLTQRMGMGSIGKAIAIYPTPWWREQGWN
FT                   AQALADTGIIRITFDNTPADVSFGAIMGFIVGDEMRRVDKMNKTEIEAAVIDSFVGMFG
FT                   PQAAHPDRVIVQRWDWEEYSRGGPVAYAPPSVLTDYGAHLRESVDGIYFAGTEASFYWT
FT                   GYMDGAVRSGERVAAEVLRSLQ"
     MALQLLSLLC LILTTAAFPV SEVDVAIIGA GLSGLSAAKD LAAAGRSFAI LEARDRVGGR        60
     VLNVELPGGI VEEVGAEFVG PTQDRVLALA AELGLTTYPT YNTGNCTLLR NGTVTNYPCE       120
     LGSGSLPPLT TEALIEVFTL QQQLNALAAE IDVETPWDHP NASIWDTMTL ETFLASQLTL       180
     SDARFLLNTF VTGILATEAN EPSLLYMLAY IAASGNETEV GTLDRLIDVA GGAQESRIVG       240
     GTQLIALRLA DRLGAENINL RSPVQRVLHC NGRYMINTNG TQISAKRVIV AMSPPMAARI       300
     SYDPPLPPAR DQLTQRMGMG SIGKAIAIYP TPWWREQGWN AQALADTGII RITFDNTPAD       360
     VSFGAIMGFI VGDEMRRVDK MNKTEIEAAV IDSFVGMFGP QAAHPDRVIV QRWDWEEYSR       420
     GGPVAYAPPS VLTDYGAHLR ESVDGIYFAG TEASFYWTGY MDGAVRSGER VAAEVLRSLQ       480
//

If you have problems or comments...

PBIL Back to PBIL home page