(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE174

ASPNC_1.PE174        Location/Qualifiers
FT   CDS             join(complement(444900..445109),complement(444536..444751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875748"
FT                   /orf_name="An01g01860"
FT                   /product="Remark: Homology is only based on repetitive
FT                   sequence"
FT                   /protein_id="CAK43557.1"
FT                   /db_xref="UniParc:UPI0000EF9E43"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T4"
FT                   /transl_table=1
FT                   /translation="MPGGLHPPLSVMESWPARNTINPESHGSASIVLPAIFGSIAVTAV
FT                   ILRLWARCVIQRQGKLDDFFIALALEPTTTAKTTTYGTTRSPNSSSRANSPSRKNSSTS
FT                   SPRASPRSPCYFSTAAWATAPPSPLASSTSSTSASPA"
     MPGGLHPPLS VMESWPARNT INPESHGSAS IVLPAIFGSI AVTAVILRLW ARCVIQRQGK        60
     LDDFFIALAL EPTTTAKTTT YGTTRSPNSS SRANSPSRKN SSTSSPRASP RSPCYFSTAA       120
     WATAPPSPLA SSTSSTSASP A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page