(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE177

ASPNC_1.PE177        Location/Qualifiers
FT   CDS             join(452001..452149,452187..452445,452531..452725,
FT                   452848..453300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875750"
FT                   /orf_name="An01g01890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43560.1"
FT                   /db_xref="UniParc:UPI0000EF9E46"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T7"
FT                   /transl_table=1
FT                   /translation="MKGSQLVPNRPLNSINQIVKQDRLDGPWHSGARWIIRDLAQSFDA
FT                   LERHWSHLSPCPILQPSRLLVNKALTATSTLSLLPSQLRLAGDIHIAAAVQVPSTRVRS
FT                   AAPLGYGAPTRAWWRWCQRQPIEQCDLDSRLPIADPCTVAWACFGQERVRSGHFCHRMR
FT                   LSRQSPMSMTKVPGTLRYIGQYYHAQKAKAVAFRQTSGGVSEISVSAITLITRSSITLK
FT                   HDHTAEYVTTIQFRFTCYTIKTVSLENQPFQSRLGGACDTPHQIIGKSALKVGGAPGIG
FT                   IRVSVVISFKGNPRHGDSWSKQGYLGTVFLAPVTTRFRGQVCREFLAITETIWMEFDTL
FT                   ADFIYCGLVGW"
     MKGSQLVPNR PLNSINQIVK QDRLDGPWHS GARWIIRDLA QSFDALERHW SHLSPCPILQ        60
     PSRLLVNKAL TATSTLSLLP SQLRLAGDIH IAAAVQVPST RVRSAAPLGY GAPTRAWWRW       120
     CQRQPIEQCD LDSRLPIADP CTVAWACFGQ ERVRSGHFCH RMRLSRQSPM SMTKVPGTLR       180
     YIGQYYHAQK AKAVAFRQTS GGVSEISVSA ITLITRSSIT LKHDHTAEYV TTIQFRFTCY       240
     TIKTVSLENQ PFQSRLGGAC DTPHQIIGKS ALKVGGAPGI GIRVSVVISF KGNPRHGDSW       300
     SKQGYLGTVF LAPVTTRFRG QVCREFLAIT ETIWMEFDTL ADFIYCGLVG W                351
//

If you have problems or comments...

PBIL Back to PBIL home page