(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE18

ASPNC_1.PE18         Location/Qualifiers
FT   CDS             join(42813..43555,43613..44137,44190..44328,44431..44462,
FT                   44516..44589,44657..45348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874687"
FT                   /orf_name="An01g00190"
FT                   /product="Induction: priB transcript was abundant in
FT                   primordia"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36869.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329780"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9EEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C5"
FT                   /transl_table=1
FT                   /translation="MDSSAALDPNKASHGRQAACLNCXKSKVRCNRGQDDASCSRCKQA
FT                   NVECIIPSHHVGRQKGVKKYALNALIFRGPQADMVKTSKRKGLEKALHQIEQAIKRPRS
FT                   NASGSEAAQKLISDLQEMLSNTREQQLHSEADDQSEDRSYTYHSPRDNNFGDNLSLDDA
FT                   ENPLQLLARASDLQLSPNEARDAHRWPPSTFPQPTGMLPSSTEGSDPAAQSYFVPIRAN
FT                   LDVGPDIDPIDIGLVTPSEAESLFSFFYQNLAHTRWGLDPLVHTVSFVRTQSAFLFTSI
FT                   MAAAALFLPSATALSKRLSRHCKSLAHNVIARRHRSVEIVLAFMVNVPWMEPGSCLGDD
FT                   DTCSYIAMALAVALDLSLNKIVLPSTSFEHSLLRRLAKAETIDAKRALYMDRFDGIEPN
FT                   SAWGRRLLRRRERTWIALFVLERGVCLARGRSYTVPSTALINYCDKWHVSDFADSRDGP
FT                   MNSMAVLRRNLVADAGSEVAQSIKNMIESFYDKWYEIWAPEIGEGHSRSLPPYVEILVT
FT                   HTRLSTYGGVINHPTAPLEVKRFFRAAGLSSALNVLRAAIQGESRLKSMPNNTVIMISF
FT                   AACSALSLSVMPEDSRSSLAPSVHNLIEETAGVLERIGATTRHRNGASVLYGRFLRALV
FT                   RRAPVSAGSQNLKVETGPLQPPPDLDGYCPVASGTQPSSIPTSFIWPEPLRFSAMSDDQ
FT                   IIDAVNRAGTAFGTSVPDVPLDDLMTWDWFDVGNAADFGF"
     MDSSAALDPN KASHGRQAAC LNCXKSKVRC NRGQDDASCS RCKQANVECI IPSHHVGRQK        60
     GVKKYALNAL IFRGPQADMV KTSKRKGLEK ALHQIEQAIK RPRSNASGSE AAQKLISDLQ       120
     EMLSNTREQQ LHSEADDQSE DRSYTYHSPR DNNFGDNLSL DDAENPLQLL ARASDLQLSP       180
     NEARDAHRWP PSTFPQPTGM LPSSTEGSDP AAQSYFVPIR ANLDVGPDID PIDIGLVTPS       240
     EAESLFSFFY QNLAHTRWGL DPLVHTVSFV RTQSAFLFTS IMAAAALFLP SATALSKRLS       300
     RHCKSLAHNV IARRHRSVEI VLAFMVNVPW MEPGSCLGDD DTCSYIAMAL AVALDLSLNK       360
     IVLPSTSFEH SLLRRLAKAE TIDAKRALYM DRFDGIEPNS AWGRRLLRRR ERTWIALFVL       420
     ERGVCLARGR SYTVPSTALI NYCDKWHVSD FADSRDGPMN SMAVLRRNLV ADAGSEVAQS       480
     IKNMIESFYD KWYEIWAPEI GEGHSRSLPP YVEILVTHTR LSTYGGVINH PTAPLEVKRF       540
     FRAAGLSSAL NVLRAAIQGE SRLKSMPNNT VIMISFAACS ALSLSVMPED SRSSLAPSVH       600
     NLIEETAGVL ERIGATTRHR NGASVLYGRF LRALVRRAPV SAGSQNLKVE TGPLQPPPDL       660
     DGYCPVASGT QPSSIPTSFI WPEPLRFSAM SDDQIIDAVN RAGTAFGTSV PDVPLDDLMT       720
     WDWFDVGNAA DFGF                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page