(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE181

ASPNC_1.PE181        Location/Qualifiers
FT   CDS             join(complement(465122..465415),complement(465009..465055),
FT                   complement(464905..464958),complement(463791..464838),
FT                   complement(463553..463729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875754"
FT                   /orf_name="An01g01940"
FT                   /product="Function: UGA4 of S. cerevisiae is a GABA-
FT                   specific high-affinity permease"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43564.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG328455"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EF9E4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U1"
FT                   /transl_table=1
FT                   /translation="MADIKAPANPAMETDGAELEKVRIAGTNQADTQLAAEFGYKPVFK
FT                   REFGYLSTFSFAVSISGLFATIMTTMSYPLEAGGSSAVVWCWLVSGAGCMCIALSVAEL
FT                   VSAYPTSGGLYFTISRLAPHDWVPSISWVTGWLNFLGQICGVASSEYGGAQMLLAIVSM
FT                   CKGMDNYEIKTTTTVGVMAGLTVITGLVNSLSTYWMEKMTKFYVIFHVCILVACAIALL
FT                   VMTDDKHDASYVFTHVESTTGWKPIGFSWLFGFLSVSWTMTDYDATAHITEEISNPEIK
FT                   APWAISMAMLFTYLAGFLFNIVLCFCMGDPNAILNSKMEQPVAQIFYNSLGKGGAIFFT
FT                   ISALLIIKFVTFTAMQSLGRTVFAFSRDRMLPFSNVWVKVSPITGTPLYAVWISVFFCI
FT                   AINLIALGSYTAVDAVFTLCSIALDWSYCIPVLCKLLFGQFKPGPWHMGIFSTVVNAWA
FT                   CLWTLFVSIIFVLPTDRPVTPDNMNYACVFLVFVLLFALVYWFISGKRFYHGPITEAVV
FT                   ADSASESNLPGDAKSEKDGQEN"
     MADIKAPANP AMETDGAELE KVRIAGTNQA DTQLAAEFGY KPVFKREFGY LSTFSFAVSI        60
     SGLFATIMTT MSYPLEAGGS SAVVWCWLVS GAGCMCIALS VAELVSAYPT SGGLYFTISR       120
     LAPHDWVPSI SWVTGWLNFL GQICGVASSE YGGAQMLLAI VSMCKGMDNY EIKTTTTVGV       180
     MAGLTVITGL VNSLSTYWME KMTKFYVIFH VCILVACAIA LLVMTDDKHD ASYVFTHVES       240
     TTGWKPIGFS WLFGFLSVSW TMTDYDATAH ITEEISNPEI KAPWAISMAM LFTYLAGFLF       300
     NIVLCFCMGD PNAILNSKME QPVAQIFYNS LGKGGAIFFT ISALLIIKFV TFTAMQSLGR       360
     TVFAFSRDRM LPFSNVWVKV SPITGTPLYA VWISVFFCIA INLIALGSYT AVDAVFTLCS       420
     IALDWSYCIP VLCKLLFGQF KPGPWHMGIF STVVNAWACL WTLFVSIIFV LPTDRPVTPD       480
     NMNYACVFLV FVLLFALVYW FISGKRFYHG PITEAVVADS ASESNLPGDA KSEKDGQEN        539
//

If you have problems or comments...

PBIL Back to PBIL home page