(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE184

ASPNC_1.PE184        Location/Qualifiers
FT   CDS             join(complement(472301..472604),complement(471917..472243),
FT                   complement(471856..471860))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806417"
FT                   /orf_name="An01g01970"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An04g02750 - Aspergillus niger"
FT                   /protein_id="CAK43567.1"
FT                   /db_xref="UniParc:UPI0000EF9E4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U4"
FT                   /transl_table=1
FT                   /translation="MGNKVSNISSIPEEFLADDWEEHYARARNPFCGYNYCCCYICGFQ
FT                   YNDSWGMRPVSYRVRGDKSYPRHPNYKAVAQAEGIEEERLRHIEYVPNRWWMWQRMIIH
FT                   REAKSTYRVSGTYLLEQETWRLCVPIMVKGKRVYVDPKVYCMGMKATSPADWVGCTVHA
FT                   RCWELLSHHALGRVAETDLPAVIAALRYRRRVVGSPCKRWEHKMFAED"
     MGNKVSNISS IPEEFLADDW EEHYARARNP FCGYNYCCCY ICGFQYNDSW GMRPVSYRVR        60
     GDKSYPRHPN YKAVAQAEGI EEERLRHIEY VPNRWWMWQR MIIHREAKST YRVSGTYLLE       120
     QETWRLCVPI MVKGKRVYVD PKVYCMGMKA TSPADWVGCT VHARCWELLS HHALGRVAET       180
     DLPAVIAALR YRRRVVGSPC KRWEHKMFAE D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page