(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE185

ASPNC_1.PE185        Location/Qualifiers
FT   CDS             join(473738..474681,474712..475185,475221..475353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876755"
FT                   /orf_name="An01g01980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43568.1"
FT                   /db_xref="UniParc:UPI0000EF9E4E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U5"
FT                   /transl_table=1
FT                   /translation="MPDFQDVEDVWHEICEYLETRDLFNICLTSRTINHVGTRYLYRKI
FT                   KWDWKGKKSRYRIMSLWTALVQDKDKRSRLCGSVREVHLLGSTPPKDTRIVECPEIQEG
FT                   NPSSLSIIRSDKVPFYQEIDYLRDVVSSVVESPKGRLAWLESIAARNVYALVALLLPLL
FT                   HNLRSLKLDYTFAVNGGYPGQMIESLTSGKEIHSAELQNNFEHLEVFDYGTNALHNNLP
FT                   HSCDNTHIRMRYSSQLIPIFQLQQVKHLKVWLRSRHGLLLARIPDVQMNHWALETLVLD
FT                   HISVMDCALFKVFKRTNKLRSLHLGMNAEEKDFCKYIWNGLRALCGCLEHLSISFSITP
FT                   RSREYRIDTIMWGPLFRHMTAGFFQDFTRLKTLELPIQMLNGFRDIMEVGIQQDLPVTL
FT                   EKLGLRWDFRDVESYDVPTATVRILWVLTEFLRLPDRHQRVPLLQEVIIRLFIGEDGLS
FT                   RTVVDCDDLIEQFNMTVDERTLMLNDVSLDIRGIMPNHRRQSYPSSTHYSLLLPDRQT"
     MPDFQDVEDV WHEICEYLET RDLFNICLTS RTINHVGTRY LYRKIKWDWK GKKSRYRIMS        60
     LWTALVQDKD KRSRLCGSVR EVHLLGSTPP KDTRIVECPE IQEGNPSSLS IIRSDKVPFY       120
     QEIDYLRDVV SSVVESPKGR LAWLESIAAR NVYALVALLL PLLHNLRSLK LDYTFAVNGG       180
     YPGQMIESLT SGKEIHSAEL QNNFEHLEVF DYGTNALHNN LPHSCDNTHI RMRYSSQLIP       240
     IFQLQQVKHL KVWLRSRHGL LLARIPDVQM NHWALETLVL DHISVMDCAL FKVFKRTNKL       300
     RSLHLGMNAE EKDFCKYIWN GLRALCGCLE HLSISFSITP RSREYRIDTI MWGPLFRHMT       360
     AGFFQDFTRL KTLELPIQML NGFRDIMEVG IQQDLPVTLE KLGLRWDFRD VESYDVPTAT       420
     VRILWVLTEF LRLPDRHQRV PLLQEVIIRL FIGEDGLSRT VVDCDDLIEQ FNMTVDERTL       480
     MLNDVSLDIR GIMPNHRRQS YPSSTHYSLL LPDRQT                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page