(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE188

ASPNC_1.PE188        Location/Qualifiers
FT   CDS             479790..480995
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959923"
FT                   /orf_name="An01g02010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43571.1"
FT                   /db_xref="UniParc:UPI0000EF9E51"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U8"
FT                   /transl_table=1
FT                   /translation="MDKPTGVASSQMDKPRLGGKMNLPAGGATTAPVRDVSNKKKRALE
FT                   EDSDSENIDDGKRTCIHLIDEAMKDLELGFEKDSEDDYESDSKTESDSDGGSSNDEDRG
FT                   NSSTEETTVIDEDSSNDEDGGDSSTEETTVSDEDSSNDEGSDLGGRDVTMDEIMDFNSE
FT                   ESTSDETMDTSDEDSSRDEASDWSVGSGSSDEEEYMDVSDAESWSSEHWNDSDQSDDED
FT                   YTFERPEAWKWSKDNNINNNKDGDEEDGDRLMIQLTYPNHTHKICDDTSSEDEDGDALI
FT                   QEEVDDASSEDEVETEDENKSGCADGDSSTAFPACEFLDKHADKPGYIYDMTSHGKNIL
FT                   ILITTSSPPTLIRASTRDLIMGSSVFAKVFGYNEEIRVSGKIFSSWRKIQKVTGCHRAE
FT                   FI"
     MDKPTGVASS QMDKPRLGGK MNLPAGGATT APVRDVSNKK KRALEEDSDS ENIDDGKRTC        60
     IHLIDEAMKD LELGFEKDSE DDYESDSKTE SDSDGGSSND EDRGNSSTEE TTVIDEDSSN       120
     DEDGGDSSTE ETTVSDEDSS NDEGSDLGGR DVTMDEIMDF NSEESTSDET MDTSDEDSSR       180
     DEASDWSVGS GSSDEEEYMD VSDAESWSSE HWNDSDQSDD EDYTFERPEA WKWSKDNNIN       240
     NNKDGDEEDG DRLMIQLTYP NHTHKICDDT SSEDEDGDAL IQEEVDDASS EDEVETEDEN       300
     KSGCADGDSS TAFPACEFLD KHADKPGYIY DMTSHGKNIL ILITTSSPPT LIRASTRDLI       360
     MGSSVFAKVF GYNEEIRVSG KIFSSWRKIQ KVTGCHRAEF I                           401
//

If you have problems or comments...

PBIL Back to PBIL home page