(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE191

ASPNC_1.PE191        Location/Qualifiers
FT   CDS             join(487264..487440,487519..487795,487845..488263,
FT                   488317..488964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876758"
FT                   /orf_name="An01g02040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43574.1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0000EF9E64"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V1"
FT                   /transl_table=1
FT                   /translation="MAKPTSDIELSPADLGLPRFVEAHLAIVVRAKPEPHDCQRAAQEL
FT                   LATYPMLAMRMDFWRTKLLHSDYPAEIYHSRTLKKDLDEVLPCQTAKVGPPAVQLLDTC
FT                   SLLDCLNFNRDIWDEICGEQVLRIRVVFLNDAWAVRFIMSHTLGDIRVPVGLNSLLSNS
FT                   MCHTAMHWIADSFFAFLSGREVQTVSPIRSILTFKSDIIDSWNALTASGTTHSVAEDHQ
FT                   HEIVAGWLPTILSGARQILWYAYEASSPRRQVNKSLFIPQCIIDHWVQGARREGIQVTE
FT                   HDLLMGFIYEATYRALSAPPHFTFLMNFHQQLHSPGPLGNTWFQIPIPALHKSKSSPST
FT                   PFPKDHSSTLLPMLLHHAQLIRDIIVKCRHPACFPEIYEQHRRLGTTPWRPRSFGTRSP
FT                   HVMVSCWTKQQWYELDCTGGTPLFVDLGACFYRLFQLLGVQGPDDFVGTIKCPGGRNST
FT                   LMGEHKGYWVQGRLPEVTWATMVDMLTAVSFGDGGGQKQGLGQTFANI"
     MAKPTSDIEL SPADLGLPRF VEAHLAIVVR AKPEPHDCQR AAQELLATYP MLAMRMDFWR        60
     TKLLHSDYPA EIYHSRTLKK DLDEVLPCQT AKVGPPAVQL LDTCSLLDCL NFNRDIWDEI       120
     CGEQVLRIRV VFLNDAWAVR FIMSHTLGDI RVPVGLNSLL SNSMCHTAMH WIADSFFAFL       180
     SGREVQTVSP IRSILTFKSD IIDSWNALTA SGTTHSVAED HQHEIVAGWL PTILSGARQI       240
     LWYAYEASSP RRQVNKSLFI PQCIIDHWVQ GARREGIQVT EHDLLMGFIY EATYRALSAP       300
     PHFTFLMNFH QQLHSPGPLG NTWFQIPIPA LHKSKSSPST PFPKDHSSTL LPMLLHHAQL       360
     IRDIIVKCRH PACFPEIYEQ HRRLGTTPWR PRSFGTRSPH VMVSCWTKQQ WYELDCTGGT       420
     PLFVDLGACF YRLFQLLGVQ GPDDFVGTIK CPGGRNSTLM GEHKGYWVQG RLPEVTWATM       480
     VDMLTAVSFG DGGGQKQGLG QTFANI                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page