(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE192

ASPNC_1.PE192        Location/Qualifiers
FT   CDS             join(complement(490623..491550),complement(490479..490527),
FT                   complement(489382..490429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110815"
FT                   /orf_name="An01g02050"
FT                   /product="Remark: At221 might be involved in the gene
FT                   expression regulation of lovF"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43575.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9E65"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V2"
FT                   /transl_table=1
FT                   /translation="MKRKAAFQLPHTPRRAPRQDPVSCDSCRLKKIKCDRQQPCSSCSA
FT                   RRLTCRYGKPEAAGTARVQKPLLAAGVERTSPPSNPTVPPRADNVPIEPTAAPLRACNR
FT                   ESLLTADWLENIHMADRVPTATPKWLRDGLDDPVRGRNLNLSLNDETGSARPLLSMPYM
FT                   NRSAIDENPASINLITFVPAKSEALDLFRYYHRYVDYLYHIIVPKRVEGQINGIYRCIE
FT                   SNAPVDLNHLALLFGILASSLCLQRSVVASTDAEARSQEFAFLTGAALIQSHYSLSPTL
FT                   VGLQATMVVMHNVSNWNIPPSVSGLFVHDLEVKRRLWWDLTSFDWLLGFLTGPQEWTYL
FT                   IQPHHMNVNQPLNIDDNAMCHNMVSMPNSTPTDMSFFLQRLTLAAVSREVVDATSYEHL
FT                   HGLEPIYEKILELDKKFHRAVAEIPDFFRLDPSSRRRFASLYEERPTIAWQGCLLQQGF
FT                   FSRLCRLHRDFFIRGAREPAYSYSHVICLQSARKVLEIKRIMDGNEPNYTPPNSVVWSV
FT                   MHHVFAAAVILLLDVCFNWDDILAEKRKEEVLDACRMLSKAQESSALVREGINAMMGVL
FT                   QKHWRTGKQAENHTITSQGADGARSHPGSAPAHVPALNAESNVMPPHLPAATNDNAPHE
FT                   RQLEDIWTEMLETGNDLALDSADWTELLNELTDPELSRG"
     MKRKAAFQLP HTPRRAPRQD PVSCDSCRLK KIKCDRQQPC SSCSARRLTC RYGKPEAAGT        60
     ARVQKPLLAA GVERTSPPSN PTVPPRADNV PIEPTAAPLR ACNRESLLTA DWLENIHMAD       120
     RVPTATPKWL RDGLDDPVRG RNLNLSLNDE TGSARPLLSM PYMNRSAIDE NPASINLITF       180
     VPAKSEALDL FRYYHRYVDY LYHIIVPKRV EGQINGIYRC IESNAPVDLN HLALLFGILA       240
     SSLCLQRSVV ASTDAEARSQ EFAFLTGAAL IQSHYSLSPT LVGLQATMVV MHNVSNWNIP       300
     PSVSGLFVHD LEVKRRLWWD LTSFDWLLGF LTGPQEWTYL IQPHHMNVNQ PLNIDDNAMC       360
     HNMVSMPNST PTDMSFFLQR LTLAAVSREV VDATSYEHLH GLEPIYEKIL ELDKKFHRAV       420
     AEIPDFFRLD PSSRRRFASL YEERPTIAWQ GCLLQQGFFS RLCRLHRDFF IRGAREPAYS       480
     YSHVICLQSA RKVLEIKRIM DGNEPNYTPP NSVVWSVMHH VFAAAVILLL DVCFNWDDIL       540
     AEKRKEEVLD ACRMLSKAQE SSALVREGIN AMMGVLQKHW RTGKQAENHT ITSQGADGAR       600
     SHPGSAPAHV PALNAESNVM PPHLPAATND NAPHERQLED IWTEMLETGN DLALDSADWT       660
     ELLNELTDPE LSRG                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page