(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE198

ASPNC_1.PE198        Location/Qualifiers
FT   CDS             join(505103..505307,505394..505662,505738..505896,
FT                   505952..507046,507131..507160,507211..507246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876761"
FT                   /orf_name="An01g02110"
FT                   /product="Similarity to hypothetical protein CAD11409.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43581.1"
FT                   /db_xref="HOGENOM:HBG325004"
FT                   /db_xref="UniParc:UPI0000EF9E6A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V8"
FT                   /transl_table=1
FT                   /translation="MTSREDSVLAARDPSLTDENDWEEFSLSEVRVLVPGKSRYANLLT
FT                   ASPENPVQVTGCLDEVEEEQEKLVLDPEYLTKRIVLENVTHFAYGQHNDGEVGFWVAGK
FT                   AGWFSISPAKGYKAIFNDVVEAIDLLYFLADRHQSKRRRKRRNWNPSVEYLCEEYVSHT
FT                   HGICEDADDSAEVFYKHHHFLLSRMLKGEEDVQWTNTCIFEHLCEKFPDDFKQIKAQYE
FT                   GAKEVESEEEEEDEQEEDKEMDEKEGQDEAEARPDTSGLSKDQADAIYKVILDLKEAGY
FT                   LAKRQLTFELLINTLVERFAIDSTDYAHDLVAARADAIIEMMDEVKTYNFDWSRKVIYR
FT                   ELKAAAKKNRVQQITLTPLRPRPSDDDESSGEESEHEDHPRLRRRRVHKSVLRPKSSVA
FT                   TKQTGKRTRSAVDDQDDDSDNNEDAMDEFETPSKVRGHDLVRDPLSTRAKRRTRSLLYD
FT                   STPIQKTPLQETLQSRNTSVSGADRETNADASELEATFEDDVTSDTWTCHVRGCEKVIH
FT                   KSNSKRGKELIQDHALAHADDTKAKIDLVFAEQRLNIGLPVDNLLSRIREMGAFDTDHP
FT                   TDDVRVQSATVRSSQHITESG"
     MTSREDSVLA ARDPSLTDEN DWEEFSLSEV RVLVPGKSRY ANLLTASPEN PVQVTGCLDE        60
     VEEEQEKLVL DPEYLTKRIV LENVTHFAYG QHNDGEVGFW VAGKAGWFSI SPAKGYKAIF       120
     NDVVEAIDLL YFLADRHQSK RRRKRRNWNP SVEYLCEEYV SHTHGICEDA DDSAEVFYKH       180
     HHFLLSRMLK GEEDVQWTNT CIFEHLCEKF PDDFKQIKAQ YEGAKEVESE EEEEDEQEED       240
     KEMDEKEGQD EAEARPDTSG LSKDQADAIY KVILDLKEAG YLAKRQLTFE LLINTLVERF       300
     AIDSTDYAHD LVAARADAII EMMDEVKTYN FDWSRKVIYR ELKAAAKKNR VQQITLTPLR       360
     PRPSDDDESS GEESEHEDHP RLRRRRVHKS VLRPKSSVAT KQTGKRTRSA VDDQDDDSDN       420
     NEDAMDEFET PSKVRGHDLV RDPLSTRAKR RTRSLLYDST PIQKTPLQET LQSRNTSVSG       480
     ADRETNADAS ELEATFEDDV TSDTWTCHVR GCEKVIHKSN SKRGKELIQD HALAHADDTK       540
     AKIDLVFAEQ RLNIGLPVDN LLSRIREMGA FDTDHPTDDV RVQSATVRSS QHITESG          597
//

If you have problems or comments...

PBIL Back to PBIL home page