(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE20

ASPNC_1.PE20         Location/Qualifiers
FT   CDS             join(complement(50042..50388),complement(49702..49963),
FT                   complement(49243..49641),complement(48862..49182),
FT                   complement(48573..48806))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959385"
FT                   /orf_name="An01g00210"
FT                   /product="Similarity to hypothetical protein AAO27753.1 -
FT                   Fusarium sporotrichioides"
FT                   /protein_id="CAK36871.1"
FT                   /db_xref="UniParc:UPI0000EF9EF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C7"
FT                   /transl_table=1
FT                   /translation="MSRYLRAFVLALAGSTLVASASTSTSNSNSWCQTSWSTDTCQLFT
FT                   ESMEYLDRIYDASAGYVYDPSAATALRHDTRTSVWYAVGLLARDQGDDVAQAMTIIRNV
FT                   IDAQFKDTSDQWYGDYQQFPEEPTVGTSAYPPIIYDTWDPNWREFIGTAFIIALEEFPH
FT                   LIDADMTQLMHASLYNDTVGDSYRVGGVDDDNLYPSYTNPSLMRAIITGWTGRKLGDQN
FT                   MTNSGETYATEIIRLFDRADTLSEFNSATYTGVSLIALTMWAKYAAEDSVMKGKGKEML
FT                   QDTWDTIGELYHAGLKNLAGPWDRAYGFDMQKYFGIMSGHIWSLVGKETSPVIDKVYMM
FT                   SHNSDFSISPLIAILSNFHNSLVPSTAIQALKTFPGEHMVNTSAYSIPYDSFPRQVAAW
FT                   LSEGISIGAETFNESVVGGPAINPSQFNPAVIQWDTGAGIGWITLYATEEALNAEVGPG
FT                   YLNLTYPRGTSASQFQFLVSPFETQKNVAGWQDIVGLNVTVSGNMDPTTLNISYSLSDQ
FT                   VIK"
     MSRYLRAFVL ALAGSTLVAS ASTSTSNSNS WCQTSWSTDT CQLFTESMEY LDRIYDASAG        60
     YVYDPSAATA LRHDTRTSVW YAVGLLARDQ GDDVAQAMTI IRNVIDAQFK DTSDQWYGDY       120
     QQFPEEPTVG TSAYPPIIYD TWDPNWREFI GTAFIIALEE FPHLIDADMT QLMHASLYND       180
     TVGDSYRVGG VDDDNLYPSY TNPSLMRAII TGWTGRKLGD QNMTNSGETY ATEIIRLFDR       240
     ADTLSEFNSA TYTGVSLIAL TMWAKYAAED SVMKGKGKEM LQDTWDTIGE LYHAGLKNLA       300
     GPWDRAYGFD MQKYFGIMSG HIWSLVGKET SPVIDKVYMM SHNSDFSISP LIAILSNFHN       360
     SLVPSTAIQA LKTFPGEHMV NTSAYSIPYD SFPRQVAAWL SEGISIGAET FNESVVGGPA       420
     INPSQFNPAV IQWDTGAGIG WITLYATEEA LNAEVGPGYL NLTYPRGTSA SQFQFLVSPF       480
     ETQKNVAGWQ DIVGLNVTVS GNMDPTTLNI SYSLSDQVIK                             520
//

If you have problems or comments...

PBIL Back to PBIL home page