(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE204

ASPNC_1.PE204        Location/Qualifiers
FT   CDS             join(523220..523457,523561..523787,523875..524159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959925"
FT                   /orf_name="An01g02170"
FT                   /product="Similarity: similarity to S. pombe hypothetical
FT                   protein SPAC13C5. 04"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK43587.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG593654"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000EF9E7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W4"
FT                   /transl_table=1
FT                   /translation="MPPLRIAILECDTPVEKVNNKYGGYRGVFSLLLRESAAALGQPDK
FT                   LDPETGLEFSGWDVVTAQEYPNLEDVDAIVLSGSKHDSFEDHPWILKLVEFTKKAFEDK
FT                   RVKIFAICFGHQILARALGARVGRNTAGWELAVCEVDLTETGKELFGRDKLRIHQMHQD
FT                   IAYGYPSEVISLGASPRCAVQGMYVPGKLISVQGHPEFREDIMTEILTLRTAAGIFSKE
FT                   QSEDAFNRAGIPHDGIAITMAFLKLLI"
     MPPLRIAILE CDTPVEKVNN KYGGYRGVFS LLLRESAAAL GQPDKLDPET GLEFSGWDVV        60
     TAQEYPNLED VDAIVLSGSK HDSFEDHPWI LKLVEFTKKA FEDKRVKIFA ICFGHQILAR       120
     ALGARVGRNT AGWELAVCEV DLTETGKELF GRDKLRIHQM HQDIAYGYPS EVISLGASPR       180
     CAVQGMYVPG KLISVQGHPE FREDIMTEIL TLRTAAGIFS KEQSEDAFNR AGIPHDGIAI       240
     TMAFLKLLI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page