(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE207

ASPNC_1.PE207        Location/Qualifiers
FT   CDS             join(complement(527094..527422),complement(526894..526999))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806673"
FT                   /orf_name="An01g02200"
FT                   /product="Catalytic activity: nucleoside triphosphate +
FT                   RNA(n) "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAK43590.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG595341"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000EF9E81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W7"
FT                   /transl_table=1
FT                   /translation="MSDPVLFEDTFTITTINSQKYDRVSRLSCNSTDTLSHFTLDVNSE
FT                   LYPCVVGESVNMALASTLSLDGKDDSGSKGWREVGMGEQTLANDYDYVCHGKVYRFEEG
FT                   SSQGNMAVFISFGGLLLYLEGPYKKLAPLRIDYVYLLLKK"
     MSDPVLFEDT FTITTINSQK YDRVSRLSCN STDTLSHFTL DVNSELYPCV VGESVNMALA        60
     STLSLDGKDD SGSKGWREVG MGEQTLANDY DYVCHGKVYR FEEGSSQGNM AVFISFGGLL       120
     LYLEGPYKKL APLRIDYVYL LLKK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page