(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE208

ASPNC_1.PE208        Location/Qualifiers
FT   CDS             join(527707..528178,528248..528957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876766"
FT                   /orf_name="An01g02210"
FT                   /product="Similarity to hypothetical protein SPCC11E10.06c
FT                   - Schizosaccharomyces pombe"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="Elongator holoenzyme complex "
FT                   /protein_id="CAK43591.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0033588"
FT                   /db_xref="HOGENOM:HBG329797"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniParc:UPI0000EF9E82"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W8"
FT                   /transl_table=1
FT                   /translation="MSFRKRNIGLSAGADRTGAVNANAQPQQPSATPELTPGVRPSPDD
FT                   GRPTTSTGTPSLDNLLAGHGGLPIGKTLLIEENGTTDFAGALLRYYAAEGVVQDQKIHI
FT                   VGMPEQWGRSLPGLLGPADAIDDKQDKRKGERMKIAWRYERLGEFGAGIAGSRAPSGDQ
FT                   SQSAADPNVDKRPAFCHAFDLTKRLTHPSIANLNYIPLAPSNEPLFVSIHKRLQAAIAS
FT                   CPPNTVHRILIPSLLNPTIYPPDSCQPDNLLPFLHSLRALMSAQGARVTAMITLPLSLF
FT                   PRATGLVRWMELLSDGVIELCPFPHSSDALATSGAATSQEEPPQGMLKVHRLPVLHERG
FT                   GGSDQNIGQDWAFTLSRKKFEIKPFSLPPAEGDKEGQDAAVTGGMPKKADLEF"
     MSFRKRNIGL SAGADRTGAV NANAQPQQPS ATPELTPGVR PSPDDGRPTT STGTPSLDNL        60
     LAGHGGLPIG KTLLIEENGT TDFAGALLRY YAAEGVVQDQ KIHIVGMPEQ WGRSLPGLLG       120
     PADAIDDKQD KRKGERMKIA WRYERLGEFG AGIAGSRAPS GDQSQSAADP NVDKRPAFCH       180
     AFDLTKRLTH PSIANLNYIP LAPSNEPLFV SIHKRLQAAI ASCPPNTVHR ILIPSLLNPT       240
     IYPPDSCQPD NLLPFLHSLR ALMSAQGARV TAMITLPLSL FPRATGLVRW MELLSDGVIE       300
     LCPFPHSSDA LATSGAATSQ EEPPQGMLKV HRLPVLHERG GGSDQNIGQD WAFTLSRKKF       360
     EIKPFSLPPA EGDKEGQDAA VTGGMPKKAD LEF                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page