(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE215

ASPNC_1.PE215        Location/Qualifiers
FT   CDS             join(complement(548800..549324),complement(548297..548484),
FT                   complement(547679..548242),complement(547427..547621),
FT                   complement(547288..547371),complement(547069..547243))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654008"
FT                   /orf_name="An01g02280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43598.1"
FT                   /db_xref="UniParc:UPI0000EF9E89"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5"
FT                   /transl_table=1
FT                   /translation="MCHTSLRFPLATTTLGACHSYLTVTLHTYNFLTHPPLARPVPPES
FT                   LFGFYLTFGSRWSFAFFLSSSPPRRQVVNLQFSTILAGDFVPLPACIPPPPPPPSPILS
FT                   QRHVPFPPAHTLHTLYFTSDISSTPGPQDLTAPQPIIRWICPQAVPIPCDPSCWVFHPS
FT                   HRLVGCPKPTVTRSTILPEKMSTQQDPNPSNEGKHDGLSKYVKRMKMALRRSSTVRTTT
FT                   PVMQKSREPEPSQAPAPQRIPQAPTVKATPDATVFTNWGAIQEEKARALFAKYGLTLEP
FT                   GEWRSPSDTTVQRVVRPIRMRVRRTCHRCQTTFGPNKVCVNCQHVRCKSCPHHPSTKTN
FT                   DHRDDTQAALQAIVAQKLHKPVPVQHKPKQPPLTLPSRTGGQDVIHHPTRQRVRRTCHQ
FT                   CSTVFAPDATECSTCQHIRCTMCPRDPPKLGKYPHGYPGDVDAPAEPPARTWKKPRQRV
FT                   RYTCHKCTTLYRSGERNCSNCGQEKGPETIRDPPRRDKPKPDPEIVRRVEERLAKVRIS
FT                   TGANGKSGFSNRLPKLRLFTYVLAPSYDKNSSSASFTLCSSRMPQGTGHATMVGGPSIV
FT                   "
     MCHTSLRFPL ATTTLGACHS YLTVTLHTYN FLTHPPLARP VPPESLFGFY LTFGSRWSFA        60
     FFLSSSPPRR QVVNLQFSTI LAGDFVPLPA CIPPPPPPPS PILSQRHVPF PPAHTLHTLY       120
     FTSDISSTPG PQDLTAPQPI IRWICPQAVP IPCDPSCWVF HPSHRLVGCP KPTVTRSTIL       180
     PEKMSTQQDP NPSNEGKHDG LSKYVKRMKM ALRRSSTVRT TTPVMQKSRE PEPSQAPAPQ       240
     RIPQAPTVKA TPDATVFTNW GAIQEEKARA LFAKYGLTLE PGEWRSPSDT TVQRVVRPIR       300
     MRVRRTCHRC QTTFGPNKVC VNCQHVRCKS CPHHPSTKTN DHRDDTQAAL QAIVAQKLHK       360
     PVPVQHKPKQ PPLTLPSRTG GQDVIHHPTR QRVRRTCHQC STVFAPDATE CSTCQHIRCT       420
     MCPRDPPKLG KYPHGYPGDV DAPAEPPART WKKPRQRVRY TCHKCTTLYR SGERNCSNCG       480
     QEKGPETIRD PPRRDKPKPD PEIVRRVEER LAKVRISTGA NGKSGFSNRL PKLRLFTYVL       540
     APSYDKNSSS ASFTLCSSRM PQGTGHATMV GGPSIV                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page