(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE216

ASPNC_1.PE216        Location/Qualifiers
FT   CDS             join(551475..551616,551659..551717,551896..551958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876769"
FT                   /orf_name="An01g02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43599.1"
FT                   /db_xref="UniParc:UPI0000EF9E8A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X6"
FT                   /transl_table=1
FT                   /translation="MKQPKNLNLHRRRSRSEKYSPTGFEGSELGFLLHRFVGTSLEGWC
FT                   WVGTGTGQDTWHENGGGDDDGDILLRIDPPTQNSSSFQHRTE"
     MKQPKNLNLH RRRSRSEKYS PTGFEGSELG FLLHRFVGTS LEGWCWVGTG TGQDTWHENG        60
     GGDDDGDILL RIDPPTQNSS SFQHRTE                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page