(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE224

ASPNC_1.PE224        Location/Qualifiers
FT   CDS             join(complement(578013..578347),complement(577409..577947),
FT                   complement(576509..577344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876775"
FT                   /orf_name="An01g02370"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43607.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG329809"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI0000EF9EA1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y4"
FT                   /transl_table=1
FT                   /translation="MLASIPQMETVRSLPRNPDMVARHPSAEDLDAAQQLISSAQAGRE
FT                   HLVDRARDDDAARGYDAYDAYDGKHTPTPYDSERPTLPSTESASNTLAERTSPKSQKDT
FT                   SFLGHSCSNCGTKSTPLWRRSPTGAMICNACGLYLKARNVARPTKRNRIQTSTEPVQPQ
FT                   PSQQQPPSIAPQHEAHTHSEGGCHGSKGSCPGGGNCNGTGGAEGCDGCPAYNNRVYKSS
FT                   ARGTVPVHAWGRPANPDSEKPLPAQEPDVPGKSGASAEGNILVSCQNCGTTVTPLWRRD
FT                   ENGHPICNACGLYYKLHGCYRPTTMKKTIIKRRKRVVPALREHSPTAATQSSNGSSASP
FT                   EASPATLARVHDDHYRYYSSEPVDHYGPMSGDRISPAAPKQFGFAPPPVDFTGFSSGPV
FT                   SLPHHPPPPRLLEPDRINAPSHSPVSQFGRRSLSPNPSGNPKKRTLAETASSAEAMSIP
FT                   TTLENGSNQLPPIMSSVNPSPPARLSSISSLLNPNSHDESRLDPSLAALSRQHHQSHQA
FT                   PPLAPPPSQLLPGVSEFDNIREERRLKLQREAEEMREMLRAKERELAELGQQ"
     MLASIPQMET VRSLPRNPDM VARHPSAEDL DAAQQLISSA QAGREHLVDR ARDDDAARGY        60
     DAYDAYDGKH TPTPYDSERP TLPSTESASN TLAERTSPKS QKDTSFLGHS CSNCGTKSTP       120
     LWRRSPTGAM ICNACGLYLK ARNVARPTKR NRIQTSTEPV QPQPSQQQPP SIAPQHEAHT       180
     HSEGGCHGSK GSCPGGGNCN GTGGAEGCDG CPAYNNRVYK SSARGTVPVH AWGRPANPDS       240
     EKPLPAQEPD VPGKSGASAE GNILVSCQNC GTTVTPLWRR DENGHPICNA CGLYYKLHGC       300
     YRPTTMKKTI IKRRKRVVPA LREHSPTAAT QSSNGSSASP EASPATLARV HDDHYRYYSS       360
     EPVDHYGPMS GDRISPAAPK QFGFAPPPVD FTGFSSGPVS LPHHPPPPRL LEPDRINAPS       420
     HSPVSQFGRR SLSPNPSGNP KKRTLAETAS SAEAMSIPTT LENGSNQLPP IMSSVNPSPP       480
     ARLSSISSLL NPNSHDESRL DPSLAALSRQ HHQSHQAPPL APPPSQLLPG VSEFDNIREE       540
     RRLKLQREAE EMREMLRAKE RELAELGQQ                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page