(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE229

ASPNC_1.PE229        Location/Qualifiers
FT   CDS             join(complement(585062..585776),complement(584681..584994))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876778"
FT                   /orf_name="An01g02420"
FT                   /product="Similarity to hypothetical protein SC6F7.17c -
FT                   Streptomyces coelicolor"
FT                   /protein_id="CAK43612.1"
FT                   /db_xref="HOGENOM:HBG329814"
FT                   /db_xref="UniParc:UPI0000EF9EA6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y9"
FT                   /transl_table=1
FT                   /translation="MKYKSPQVESETDAADAPKRKLDQRDPDISTGEGSLEVEKEQPPT
FT                   KASKSAANTVEEDDEVQEDSGYKDEEFEEEGEEDNEEFDEEEEYDEADDENVDFVKEQG
FT                   GEEEEDQDAEGEEDDEGEAKERVSSKPKLQKVVKEFGRPPLYGTEIAEGRLESSPDTLL
FT                   AMVMDAMLKSRPISHDLTQRAVNKLIEVGYHDIRKLGESSWEERTMVLKDGGYNRYREQ
FT                   GATNLGDLAEFVNEKYDGDLNNLLKKAHNDRDETRKLIKEIKGLGDLGVDLFFNNAQAV
FT                   WPSIAPFIDGRSLETADNVGLGTDLDAIYADLGRDSMSMSRLANGLSAVRLEKRQGDLM
FT                   AI"
     MKYKSPQVES ETDAADAPKR KLDQRDPDIS TGEGSLEVEK EQPPTKASKS AANTVEEDDE        60
     VQEDSGYKDE EFEEEGEEDN EEFDEEEEYD EADDENVDFV KEQGGEEEED QDAEGEEDDE       120
     GEAKERVSSK PKLQKVVKEF GRPPLYGTEI AEGRLESSPD TLLAMVMDAM LKSRPISHDL       180
     TQRAVNKLIE VGYHDIRKLG ESSWEERTMV LKDGGYNRYR EQGATNLGDL AEFVNEKYDG       240
     DLNNLLKKAH NDRDETRKLI KEIKGLGDLG VDLFFNNAQA VWPSIAPFID GRSLETADNV       300
     GLGTDLDAIY ADLGRDSMSM SRLANGLSAV RLEKRQGDLM AI                          342
//

If you have problems or comments...

PBIL Back to PBIL home page