(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE23

ASPNC_1.PE23         Location/Qualifiers
FT   CDS             join(57893..58022,58074..58217,58597..59378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874689"
FT                   /orf_name="An01g00250"
FT                   /product="Catalytic activity: NADH + Nitrate  "
FT                   /EC_number="1.7.1.1"
FT                   /function="heme binding"
FT                   /function="nitrate reductase (NADH) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43417.1"
FT                   /db_xref="GO:0009703"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0000EF9EF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D3"
FT                   /transl_table=1
FT                   /translation="MAQSVPLESTASMGADSQLTEYTLADIAKHNRKDDIWIAVHGQVF
FT                   DITEYLQDHPGGVDVLLETAGSDATTAFEDVGHSEDSREILQEYLIVVRADPHMAKGFL
FT                   DSKEYQRLPLVQKDLLSPNVYRFVFALPDTKGVIGLPIGQHVAIRANIDGNTVSRSYTP
FT                   VSNNLDLGRLELVVKCYPDGLLSGKYLANLTVGDEVEFRGPKGAMRYGRGLCAKIGMVA
FT                   GGTGITPMYQLIRAICEDERDTTEISLIYANRSEGDILLREELEDFARKYPKNFKLWYM
FT                   LDTAPEGWMYGSGYVNEAVLRERLPDPSAETKIMLCGPPGMVNACKKTLGVIGFQTSGT
FT                   ISKMSDQIFCF"
     MAQSVPLEST ASMGADSQLT EYTLADIAKH NRKDDIWIAV HGQVFDITEY LQDHPGGVDV        60
     LLETAGSDAT TAFEDVGHSE DSREILQEYL IVVRADPHMA KGFLDSKEYQ RLPLVQKDLL       120
     SPNVYRFVFA LPDTKGVIGL PIGQHVAIRA NIDGNTVSRS YTPVSNNLDL GRLELVVKCY       180
     PDGLLSGKYL ANLTVGDEVE FRGPKGAMRY GRGLCAKIGM VAGGTGITPM YQLIRAICED       240
     ERDTTEISLI YANRSEGDIL LREELEDFAR KYPKNFKLWY MLDTAPEGWM YGSGYVNEAV       300
     LRERLPDPSA ETKIMLCGPP GMVNACKKTL GVIGFQTSGT ISKMSDQIFC F                351
//

If you have problems or comments...

PBIL Back to PBIL home page