(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE231

ASPNC_1.PE231        Location/Qualifiers
FT   CDS             join(588488..588713,588810..589237,589289..590047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110820"
FT                   /orf_name="An01g02440"
FT                   /product="Similarity to hypothetical protein K21H1.13 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK43614.1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI0000EF9EA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z1"
FT                   /transl_table=1
FT                   /translation="MADAPNGGRIVPIVTTARQHYSSSPTDESMAKTTPQTSQKTKMPR
FT                   NARNKTAEAETLEIPCLNALGLYALPTEGDGNCLYYALSDQTYGDFTHADEIRDRLADH
FT                   ISANKDYFMSFIAAAGGERRAPRRAAAAAARQSYCSSSSASPAPPSAKDKERSFDSKVA
FT                   ESRKKGVWGGAEEIQAFCQAFKKDVCVYTMYGIQNFRDVHAPEGEERDIIHIAFHDFHH
FT                   YSSVRHSDGPHTGLPCIPKVGKEREAEASAAEPTVVDMATPWKISAIQEGLGGKYDQGA
FT                   IVEMLQQCRGNIDRAFMNLLGEDSNTSLADAPSSKAIMKSRLQASSRSSSPFSVGSKRS
FT                   ADESDADDSPQPAVRRTRTRESKRRILPDVMVGIEFRDDQNDLVSLRLRVSPDTVVPKP
FT                   AVQPSTEQAEASSLESATDSPSLLPQDRKLRIRSKTVSSETSSIPNESSDERKPPRRSQ
FT                   RISRTRPAPRSA"
     MADAPNGGRI VPIVTTARQH YSSSPTDESM AKTTPQTSQK TKMPRNARNK TAEAETLEIP        60
     CLNALGLYAL PTEGDGNCLY YALSDQTYGD FTHADEIRDR LADHISANKD YFMSFIAAAG       120
     GERRAPRRAA AAAARQSYCS SSSASPAPPS AKDKERSFDS KVAESRKKGV WGGAEEIQAF       180
     CQAFKKDVCV YTMYGIQNFR DVHAPEGEER DIIHIAFHDF HHYSSVRHSD GPHTGLPCIP       240
     KVGKEREAEA SAAEPTVVDM ATPWKISAIQ EGLGGKYDQG AIVEMLQQCR GNIDRAFMNL       300
     LGEDSNTSLA DAPSSKAIMK SRLQASSRSS SPFSVGSKRS ADESDADDSP QPAVRRTRTR       360
     ESKRRILPDV MVGIEFRDDQ NDLVSLRLRV SPDTVVPKPA VQPSTEQAEA SSLESATDSP       420
     SLLPQDRKLR IRSKTVSSET SSIPNESSDE RKPPRRSQRI SRTRPAPRSA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page