(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE232

ASPNC_1.PE232        Location/Qualifiers
FT   CDS             join(complement(594085..594621),complement(593847..594032),
FT                   complement(592328..593782))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959928"
FT                   /orf_name="An01g02460"
FT                   /product="Similarity to hypothetical protein EAA66045.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK43615.1"
FT                   /db_xref="HOGENOM:HBG325012"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniParc:UPI0000EF9EA9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z2"
FT                   /transl_table=1
FT                   /translation="MGGVGIWCMHYIGNRAIVLGNGEAQFQIIYSMTFTGVSFVLPVVV
FT                   LLVAFYSIGASEKAGYIRILTGGVLTGGAVCGMHYIGQLGISNYRCSYRVANIVGATII
FT                   AVFASTVALTVFFRWRATWTDSWWRRGICGCVLALAVSGMHWTAAVGTYYYNHDTTMKH
FT                   NGQLSRSQVVIISSVLACAACGVLTACAVVAGGNRRRLNIQARQLVLTCAFFDQSGRIM
FT                   VTPHALLPSRKIVDRYVGRTFNDDDLTRSHPAFLWAFRASRHWNLVKDVVPFMRSRIET
FT                   DKEATEHFLAKGEALDQENELQNDFDELFKRHFCVTAQDLADEVRQPLPALGKLYDDVL
FT                   VTTAPTSRFSRAMGYSRLNNSKGQMLFTVRHLDKQEANRLAAAGFRFTAVENVTSVLSS
FT                   RMHIPLPVLGEHLKDMRDYATGGRNYEPGVHLVSFVMRPTISDHFEVLTAKGTGNPLPS
FT                   STLPIKRINIQHLDLISHMEGWTISTCLSWLKSEAAQSNKEIDDFREQLIHAMTSLESA
FT                   LPPDINMASKFSARPLIAPCRMFSDSDASNSILLPFCAVGNLDTQVSNPDFTFMPLRLF
FT                   RAQQQLNDANIGSDGFAKELGRELYYSNARSSSATEADITPSIRSVLKLWPRKHADSPH
FT                   GDLSQETLTELSQLGDIMVRKEVKVDVAKLSTRSLDSAKHASHATVVAGDLATSSYVDE
FT                   LYNLCYSPGVRLRPDTAITRSSVTRSSMATG"
     MGGVGIWCMH YIGNRAIVLG NGEAQFQIIY SMTFTGVSFV LPVVVLLVAF YSIGASEKAG        60
     YIRILTGGVL TGGAVCGMHY IGQLGISNYR CSYRVANIVG ATIIAVFAST VALTVFFRWR       120
     ATWTDSWWRR GICGCVLALA VSGMHWTAAV GTYYYNHDTT MKHNGQLSRS QVVIISSVLA       180
     CAACGVLTAC AVVAGGNRRR LNIQARQLVL TCAFFDQSGR IMVTPHALLP SRKIVDRYVG       240
     RTFNDDDLTR SHPAFLWAFR ASRHWNLVKD VVPFMRSRIE TDKEATEHFL AKGEALDQEN       300
     ELQNDFDELF KRHFCVTAQD LADEVRQPLP ALGKLYDDVL VTTAPTSRFS RAMGYSRLNN       360
     SKGQMLFTVR HLDKQEANRL AAAGFRFTAV ENVTSVLSSR MHIPLPVLGE HLKDMRDYAT       420
     GGRNYEPGVH LVSFVMRPTI SDHFEVLTAK GTGNPLPSST LPIKRINIQH LDLISHMEGW       480
     TISTCLSWLK SEAAQSNKEI DDFREQLIHA MTSLESALPP DINMASKFSA RPLIAPCRMF       540
     SDSDASNSIL LPFCAVGNLD TQVSNPDFTF MPLRLFRAQQ QLNDANIGSD GFAKELGREL       600
     YYSNARSSSA TEADITPSIR SVLKLWPRKH ADSPHGDLSQ ETLTELSQLG DIMVRKEVKV       660
     DVAKLSTRSL DSAKHASHAT VVAGDLATSS YVDELYNLCY SPGVRLRPDT AITRSSVTRS       720
     SMATG                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page