(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE233

ASPNC_1.PE233        Location/Qualifiers
FT   CDS             join(595077..595142,595217..595347,595413..595463,
FT                   595544..595732,595820..595939,596047..596166,5
FT                   96268..596442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876779"
FT                   /orf_name="An01g02470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43616.1"
FT                   /db_xref="UniParc:UPI0000EF9EAA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z3"
FT                   /transl_table=1
FT                   /translation="MAFSFQELHAAGPYYVLAMVLQWEPLIACGGHRDPSNFYVGCTRP
FT                   INMRGPQNEGLALFQRSHWAITIDRGCNQEPWGIEFTGKLKFFPSAKVGYYLSTRWVYV
FT                   YGSRRIRTAKANPVGRGPRRFSCAVWLNLRSSPKINQFCTIGLPLMARSPSAHRSQLHR
FT                   LNHPLATNTSRVLNLGSNYPEGPADSPIASTHAVDKDPEWSVDAVAGLARGTSIGNHAI
FT                   HRHGLAPLDELNVAEWEVREGERSRRSSEMHSRWTITRALGHFGVRQQPRDSDRGFLFS
FT                   IG"
     MAFSFQELHA AGPYYVLAMV LQWEPLIACG GHRDPSNFYV GCTRPINMRG PQNEGLALFQ        60
     RSHWAITIDR GCNQEPWGIE FTGKLKFFPS AKVGYYLSTR WVYVYGSRRI RTAKANPVGR       120
     GPRRFSCAVW LNLRSSPKIN QFCTIGLPLM ARSPSAHRSQ LHRLNHPLAT NTSRVLNLGS       180
     NYPEGPADSP IASTHAVDKD PEWSVDAVAG LARGTSIGNH AIHRHGLAPL DELNVAEWEV       240
     REGERSRRSS EMHSRWTITR ALGHFGVRQQ PRDSDRGFLF SIG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page