(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE235

ASPNC_1.PE235        Location/Qualifiers
FT   CDS             join(complement(599145..599448),complement(598989..599064),
FT                   complement(598824..598933),complement(598714..598733))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876781"
FT                   /orf_name="An01g02490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43618.1"
FT                   /db_xref="UniParc:UPI0000EF9EAC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z5"
FT                   /transl_table=1
FT                   /translation="MVSSVQLTSCDLLRTFRFCANNLIFHTLTFWGGGGGGIQTNHTTS
FT                   YVFLTSVTGMNRGSNTPSSYAAAITLPGQLLTNLRDPLVEKIVVKVFHVAVPGCSYKWE
FT                   YLGRWLQIDPDDCTNTGQAEYGCYGPKYEQYINRPEIENRLSLSYISDALFSGIHLSID
FT                   QHELMG"
     MVSSVQLTSC DLLRTFRFCA NNLIFHTLTF WGGGGGGIQT NHTTSYVFLT SVTGMNRGSN        60
     TPSSYAAAIT LPGQLLTNLR DPLVEKIVVK VFHVAVPGCS YKWEYLGRWL QIDPDDCTNT       120
     GQAEYGCYGP KYEQYINRPE IENRLSLSYI SDALFSGIHL SIDQHELMG                   169
//

If you have problems or comments...

PBIL Back to PBIL home page