(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE24

ASPNC_1.PE24         Location/Qualifiers
FT   CDS             join(60604..60655,61102..61610,61680..63410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874690"
FT                   /orf_name="An01g00260"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43418.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329822"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9EF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D4"
FT                   /transl_table=1
FT                   /translation="MKGQGYMDFDLSRSQESALLYRNPTMSTISSMPHSPTDASSPLQS
FT                   YARTCSSCRQRKVKCDRQRPCINCSRSGVECIYPPGRGRAPKRPRNAVNAQLSHRLTRL
FT                   ESIIRSFEYHQNQESSTHPPAAPVALSSRAGSRASETSRIQSVPRTSNSDSENSIEQHL
FT                   GRLLIDDTRSYYVSNVLWANLGDEIAELRDLLHEPLVEEDSAFLEEPVPERPLPTGSNA
FT                   AILGFRALAHSLHPYHPPLTESVTLFGVFQENVSPMVRIFHMPTLARNYWDAVASLESL
FT                   DKDTEALLFAIYYSAVISMEPEQCLRTIGVSKAHASETYLFAVEQALARADLLNTQSVT
FT                   LLQAAVLFLFALRNEDDSRTVWSLTALIFHIAQAMGLHRDGVVFGLKPMETELRRRLWW
FT                   HICLLDARSSEYHGCEPIVRDSAFDTKLPLNVEDADLTADMSELPTERTGVTGMYFCLI
FT                   RCEVMRTMWKLSCVAPGLGGSRLGTGRPSLKEREALVQNLHDRLEERYLQHCDISQPFG
FT                   LASTFVARLMVARAWLVARYLLDEKEHGDNLSGPVRDQLFMSSIEVLELSSLVLTNKAI
FT                   AHWSWHSKTHIQWHAVAFVLSEICTRPPSADCDRAWQYVNTVYNNWKMKESGRKGTLWR
FT                   PIRRLMAKAQYIREMQELDPAGRGRQRAPPNRDSMQGVLGPEMCWGTNAAYVSTPVDTA
FT                   CNVVGALPSEILAGTLDPFEELFPGAPHVESSAHEPCDNIGPMLPLYDDSHIPEWLVPE
FT                   WIRNPPGNGE"
     MKGQGYMDFD LSRSQESALL YRNPTMSTIS SMPHSPTDAS SPLQSYARTC SSCRQRKVKC        60
     DRQRPCINCS RSGVECIYPP GRGRAPKRPR NAVNAQLSHR LTRLESIIRS FEYHQNQESS       120
     THPPAAPVAL SSRAGSRASE TSRIQSVPRT SNSDSENSIE QHLGRLLIDD TRSYYVSNVL       180
     WANLGDEIAE LRDLLHEPLV EEDSAFLEEP VPERPLPTGS NAAILGFRAL AHSLHPYHPP       240
     LTESVTLFGV FQENVSPMVR IFHMPTLARN YWDAVASLES LDKDTEALLF AIYYSAVISM       300
     EPEQCLRTIG VSKAHASETY LFAVEQALAR ADLLNTQSVT LLQAAVLFLF ALRNEDDSRT       360
     VWSLTALIFH IAQAMGLHRD GVVFGLKPME TELRRRLWWH ICLLDARSSE YHGCEPIVRD       420
     SAFDTKLPLN VEDADLTADM SELPTERTGV TGMYFCLIRC EVMRTMWKLS CVAPGLGGSR       480
     LGTGRPSLKE REALVQNLHD RLEERYLQHC DISQPFGLAS TFVARLMVAR AWLVARYLLD       540
     EKEHGDNLSG PVRDQLFMSS IEVLELSSLV LTNKAIAHWS WHSKTHIQWH AVAFVLSEIC       600
     TRPPSADCDR AWQYVNTVYN NWKMKESGRK GTLWRPIRRL MAKAQYIREM QELDPAGRGR       660
     QRAPPNRDSM QGVLGPEMCW GTNAAYVSTP VDTACNVVGA LPSEILAGTL DPFEELFPGA       720
     PHVESSAHEP CDNIGPMLPL YDDSHIPEWL VPEWIRNPPG NGE                         763
//

If you have problems or comments...

PBIL Back to PBIL home page