(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE245

ASPNC_1.PE245        Location/Qualifiers
FT   CDS             join(614759..614780,614879..615002,615065..615253,
FT                   615305..617420,617475..617570)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654012"
FT                   /orf_name="An01g02600"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAK43628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG604608"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI0000EF9ECE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q805"
FT                   /transl_table=1
FT                   /translation="MASRRCPFKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCALGNIASVEMSRDLFPEVENLMSTANPYIRRKAALC
FT                   AMRVCRKVPDLQEHFLEKAKTLLSDRNHGVLLCGLTLAIDMCEAEEAEEGQEGVIEMFR
FT                   PLAGGLVRSLKGLTTSGYAPEHDVSGITDPFLQVKILRLLRVLGRGDAATSEMINDILA
FT                   QVATNTDSTKNVGNAILYEAVLTILDIEADSGLRVLGVNILGKFLTNKDNNIRYVALNT
FT                   LNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINESNVRVLVRELLAFLE
FT                   VADNEFKPAMTTQIGIAADRYAPNKRWHVDTILRVLKLAGAYVKEQILSSFVRLIATTP
FT                   ELQTYSVQKLYLSLKEDISQEGLTLAATWVIGEYGDNLLQGGQYEEEELVKEVKESDIV
FT                   DLFTNILNSTYATQTVVEYITTASMKLTVRMSDPAQVERLRRFLSSRTADLSVEIQQRA
FT                   VEYVNLFGYDQIRRGVLERMPPPEIREEQRVLGAPTKKRQSKILKDKSKKPAKQAEQDM
FT                   LLDLMGGDAPPTSPTTNGSQNTADLLADILGGDSSLSSPSPQPAQKAAGSTNTSAIMDL
FT                   FNTNGSTPSPKPAEPASSGLDLLAGLSSSASPAPTPAPSATPAHTAFNKNDLSLALQVQ
FT                   RGSGGSAQIQARFRNNSSFGRFSNVGLQAAVPKSQKLQLSAINKADLDAGDEGIQMLKV
FT                   AALTGALPPKLRLRLRITYAKDGSDPVTDQVDWTEP"
     MASRRCPFKQ FIRNVRSAKT IADERAVIQK ESAAIRASFR EESHDSGIRR NNVAKLLYLF        60
     TLGERTHFGQ IECLKLLASH RFADKRLGYL GTMLLLDENQ EVLTLVTNSL KNDLNHSNQY       120
     IVGLALCALG NIASVEMSRD LFPEVENLMS TANPYIRRKA ALCAMRVCRK VPDLQEHFLE       180
     KAKTLLSDRN HGVLLCGLTL AIDMCEAEEA EEGQEGVIEM FRPLAGGLVR SLKGLTTSGY       240
     APEHDVSGIT DPFLQVKILR LLRVLGRGDA ATSEMINDIL AQVATNTDST KNVGNAILYE       300
     AVLTILDIEA DSGLRVLGVN ILGKFLTNKD NNIRYVALNT LNKVVAIEPN AVQRHRNTIL       360
     ECLRDPDISI RRRALDLSFM LINESNVRVL VRELLAFLEV ADNEFKPAMT TQIGIAADRY       420
     APNKRWHVDT ILRVLKLAGA YVKEQILSSF VRLIATTPEL QTYSVQKLYL SLKEDISQEG       480
     LTLAATWVIG EYGDNLLQGG QYEEEELVKE VKESDIVDLF TNILNSTYAT QTVVEYITTA       540
     SMKLTVRMSD PAQVERLRRF LSSRTADLSV EIQQRAVEYV NLFGYDQIRR GVLERMPPPE       600
     IREEQRVLGA PTKKRQSKIL KDKSKKPAKQ AEQDMLLDLM GGDAPPTSPT TNGSQNTADL       660
     LADILGGDSS LSSPSPQPAQ KAAGSTNTSA IMDLFNTNGS TPSPKPAEPA SSGLDLLAGL       720
     SSSASPAPTP APSATPAHTA FNKNDLSLAL QVQRGSGGSA QIQARFRNNS SFGRFSNVGL       780
     QAAVPKSQKL QLSAINKADL DAGDEGIQML KVAALTGALP PKLRLRLRIT YAKDGSDPVT       840
     DQVDWTEP                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page