(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE247

ASPNC_1.PE247        Location/Qualifiers
FT   CDS             join(621072..621231,621613..621723,621789..621916,
FT                   622013..622270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876791"
FT                   /orf_name="An01g02620"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43630.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EF9ED0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q807"
FT                   /transl_table=1
FT                   /translation="MSSTSPSKEPEVEPEVQSGEDQEQMDKEQQDTQAQGQGEFEVKEQ
FT                   DRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVN
FT                   GEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPTSSGYGAGAPVGAPGPAG
FT                   PGGRPMAPGAGFPDAADSANNIMNQSLDPSEQDTSAYGYPPMVGQPHNGTAGESY"
     MSSTSPSKEP EVEPEVQSGE DQEQMDKEQQ DTQAQGQGEF EVKEQDRWLP IANVARIMKL        60
     ALPENAKIAK EAKECMQECV SEFISFITSE ASEKCQQEKR KTVNGEDILF AMTSLGFENY       120
     AEALKIYLSK YRETQSARGE HQNRPTSSGY GAGAPVGAPG PAGPGGRPMA PGAGFPDAAD       180
     SANNIMNQSL DPSEQDTSAY GYPPMVGQPH NGTAGESY                               218
//

If you have problems or comments...

PBIL Back to PBIL home page