(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE248

ASPNC_1.PE248        Location/Qualifiers
FT   CDS             join(complement(624509..625761),complement(623303..624449))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876792"
FT                   /orf_name="An01g02630"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43631.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329829"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9ED1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q808"
FT                   /transl_table=1
FT                   /translation="MSMKDLAYICYSSPGSNENSPLGSAACVHCHRRKVRCDARIVGLP
FT                   CSNCRSAGKTDCRIHEKKKRLAVRSILDPVPIRCRPPPASSEPTHRHSLPLTATTPPDA
FT                   FTTTFRGVQPEVTTPVAHPASSLHNLHQTLNHNVNHHPPHNGAGSAAESPTYNRPAGQD
FT                   VSAESDSHADLEKRLVKLIDEEESGSREIRRGVRAIYVGHELSNMSFLIRQQRDKDDDV
FT                   YHFAGNEIPRRQLRTGHDQLLMDALTLPEPALADELVQAYFDHVNPGYPIIDEDLFMAQ
FT                   YRNRDPADPPPILLLQAILLVGAHVTRPKAERDALKDIFFRRAKWLFDSRIERNRDILV
FT                   QAALLLTWHSDGADDDVAANAHYWVGVAARIATGLGMHRNPISSRFVSRDRRMWRRLWH
FT                   IIVQFDVMVSLSYGRPQAINLEDSDVSPLTISDFEGCGPRVQSDYVIHFTELSVMISYI
FT                   VRSRFGLRVSAERRKAVLLEADEALANWSLKLPDKLRLRASDMDPWSAMLHLTYNNFLI
FT                   LLHRPHPRASAYSDDYGPHDAEICSAAAGVITSIFEELRLNDRLKFLWYSGVHTLFTAM
FT                   IQVRVELRFSNPVLAINALRRFDSASYSLRELASYWFHANTILRLFEDSRRLQEDLRMA
FT                   TSERPPRRFSNPQDQLKTTLHSTTTSTSAPTAMQTPRPPNPTPTDRPLPFEVPTPDSST
FT                   NHLPTSPHHSHPQPQSQPQQHHHLDAWIPPPPPSATMTPVVDAIDADAPRESLDWRQLF
FT                   SFTDLDQPVLPMAMEGLPELEDEWRQIYWQETPMSDLLLDGGWMHG"
     MSMKDLAYIC YSSPGSNENS PLGSAACVHC HRRKVRCDAR IVGLPCSNCR SAGKTDCRIH        60
     EKKKRLAVRS ILDPVPIRCR PPPASSEPTH RHSLPLTATT PPDAFTTTFR GVQPEVTTPV       120
     AHPASSLHNL HQTLNHNVNH HPPHNGAGSA AESPTYNRPA GQDVSAESDS HADLEKRLVK       180
     LIDEEESGSR EIRRGVRAIY VGHELSNMSF LIRQQRDKDD DVYHFAGNEI PRRQLRTGHD       240
     QLLMDALTLP EPALADELVQ AYFDHVNPGY PIIDEDLFMA QYRNRDPADP PPILLLQAIL       300
     LVGAHVTRPK AERDALKDIF FRRAKWLFDS RIERNRDILV QAALLLTWHS DGADDDVAAN       360
     AHYWVGVAAR IATGLGMHRN PISSRFVSRD RRMWRRLWHI IVQFDVMVSL SYGRPQAINL       420
     EDSDVSPLTI SDFEGCGPRV QSDYVIHFTE LSVMISYIVR SRFGLRVSAE RRKAVLLEAD       480
     EALANWSLKL PDKLRLRASD MDPWSAMLHL TYNNFLILLH RPHPRASAYS DDYGPHDAEI       540
     CSAAAGVITS IFEELRLNDR LKFLWYSGVH TLFTAMIQVR VELRFSNPVL AINALRRFDS       600
     ASYSLRELAS YWFHANTILR LFEDSRRLQE DLRMATSERP PRRFSNPQDQ LKTTLHSTTT       660
     STSAPTAMQT PRPPNPTPTD RPLPFEVPTP DSSTNHLPTS PHHSHPQPQS QPQQHHHLDA       720
     WIPPPPPSAT MTPVVDAIDA DAPRESLDWR QLFSFTDLDQ PVLPMAMEGL PELEDEWRQI       780
     YWQETPMSDL LLDGGWMHG                                                    799
//

If you have problems or comments...

PBIL Back to PBIL home page