(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE251

ASPNC_1.PE251        Location/Qualifiers
FT   CDS             join(630725..630895,631054..631349,631403..631647,
FT                   631707..631737,631815..632175)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876793"
FT                   /orf_name="An01g02660"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An03g05810 - Aspergillus niger"
FT                   /protein_id="CAK43634.1"
FT                   /db_xref="UniParc:UPI0000EF9ED4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811"
FT                   /transl_table=1
FT                   /translation="MTAVSSEYAHQTKGPRILAVFWTMTSLAILAVAARLFIRIKVLRN
FT                   PGADDWLIATSMTRTRSASQLYQLRLGHNLLRLTQISRGCPAEPFSESDNDTTRDLMGI
FT                   DGVCGTGVVYLHLGALYHVRSSESSLGHVPSVKGRELPELVDPCGLCHLHWSHICLYGS
FT                   VFGNLSDSHLTKASYVDAETIGVVCSAGSECSVSKNSRSSSSSVLAKKQGYSACAMAII
FT                   KCMQLPGLADLSDTTYATADLVIWTSIESNVVILASCIPTLQPLLEIILGKRSLRSTGG
FT                   YQYKESSTQLPESNKWSSKRSGHRKSKGNMMIADIGSQDSILQIGDDHEDESHYMGHIR
FT                   RTDKITVVYESVTPQPGGGDKTNDPVK"
     MTAVSSEYAH QTKGPRILAV FWTMTSLAIL AVAARLFIRI KVLRNPGADD WLIATSMTRT        60
     RSASQLYQLR LGHNLLRLTQ ISRGCPAEPF SESDNDTTRD LMGIDGVCGT GVVYLHLGAL       120
     YHVRSSESSL GHVPSVKGRE LPELVDPCGL CHLHWSHICL YGSVFGNLSD SHLTKASYVD       180
     AETIGVVCSA GSECSVSKNS RSSSSSVLAK KQGYSACAMA IIKCMQLPGL ADLSDTTYAT       240
     ADLVIWTSIE SNVVILASCI PTLQPLLEII LGKRSLRSTG GYQYKESSTQ LPESNKWSSK       300
     RSGHRKSKGN MMIADIGSQD SILQIGDDHE DESHYMGHIR RTDKITVVYE SVTPQPGGGD       360
     KTNDPVK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page