(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE252

ASPNC_1.PE252        Location/Qualifiers
FT   CDS             join(complement(633514..633703),complement(632522..633483))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876794"
FT                   /orf_name="An01g02670"
FT                   /product="Function: the S. pombe scn1 protein interact with
FT                   the CUT9 protein"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAK43635.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG329832"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="UniParc:UPI0000EF9ED5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q812"
FT                   /transl_table=1
FT                   /translation="MSETDQNDAFPWHLGVFDAHCHPTDTMSSIAEIPQMKVLTLTVMS
FT                   TRGEDQDLVLQTATSLTQGPVLPCFGWHPWFSHQIIDDTTGSPKTDESTSPIELKKLHY
FT                   KKVLTPEPDDDFILSLPDPKPLSELLSESRARLLAYPRSLVGEVGLDRAFRLPKAWTEE
FT                   EKETRDERMTPGSREGRQLSPYRVQLAHQKAVLEAQLRLAGELQRPVSVHSVQAHGAVF
FT                   DLLKALWSGHERKNASRRERRRRYSVPDAHAESDAEDERMQQKPAKSDEKSLPFPPRIC
FT                   MHSYSGPVEPLKQFLHQSNPSDVYFSFSSVINFGGPSSQKVINVIKALPDDRILIESDL
FT                   HTAGQQMDDLLEEIARQICNIRGWELHQGVRQLAENWKRFVLG"
     MSETDQNDAF PWHLGVFDAH CHPTDTMSSI AEIPQMKVLT LTVMSTRGED QDLVLQTATS        60
     LTQGPVLPCF GWHPWFSHQI IDDTTGSPKT DESTSPIELK KLHYKKVLTP EPDDDFILSL       120
     PDPKPLSELL SESRARLLAY PRSLVGEVGL DRAFRLPKAW TEEEKETRDE RMTPGSREGR       180
     QLSPYRVQLA HQKAVLEAQL RLAGELQRPV SVHSVQAHGA VFDLLKALWS GHERKNASRR       240
     ERRRRYSVPD AHAESDAEDE RMQQKPAKSD EKSLPFPPRI CMHSYSGPVE PLKQFLHQSN       300
     PSDVYFSFSS VINFGGPSSQ KVINVIKALP DDRILIESDL HTAGQQMDDL LEEIARQICN       360
     IRGWELHQGV RQLAENWKRF VLG                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page