(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE255

ASPNC_1.PE255        Location/Qualifiers
FT   CDS             join(638437..639055,639150..639832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211767" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876797"
FT                   /orf_name="An01g02700"
FT                   /product="Similarity to hypothetical protein SPBC902.03 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43638.1"
FT                   /db_xref="HOGENOM:HBG323873"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniParc:UPI0000EF9ED8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q815"
FT                   /transl_table=1
FT                   /translation="MASASLDQLVKGSPAPNSRLASSATSSSESLAPAFHSHPPSSDPS
FT                   SPPRSSTPDPLSTLPSSPPQIYLNLLILESSLRAQYLALRERRRQNTFFLLLLAAWIAY
FT                   FAYALFLRPREDGRGVGGSVYWVVEMGEKVALMGGVVTALLVWGTGQWERGVSLAAALA
FT                   RRSQPRPPHHEHQDRGHPRSLVAGAFLLPFFPISILCTLFPVPRLVQEDLSPGGDYIRL
FT                   LLLPKSFSPEFRENWDEYRSEFWDKENDRRAQLRQKLRQRERQLVQQDGGWFWWFGLSW
FT                   KASQRRRVAAATISRPGDADKVQHRSHHHHHSSSISKLALESKSPLRRGGPRSESHSRT
FT                   PSRSTTPVDTDDRPPSRSSVSGRPRRGSTSPSTEQHIQQSRKKKASKAATRGLSPLTQA
FT                   QIREGVRTPSFSSDDSSFMGTPSEKEKPKDESVE"
     MASASLDQLV KGSPAPNSRL ASSATSSSES LAPAFHSHPP SSDPSSPPRS STPDPLSTLP        60
     SSPPQIYLNL LILESSLRAQ YLALRERRRQ NTFFLLLLAA WIAYFAYALF LRPREDGRGV       120
     GGSVYWVVEM GEKVALMGGV VTALLVWGTG QWERGVSLAA ALARRSQPRP PHHEHQDRGH       180
     PRSLVAGAFL LPFFPISILC TLFPVPRLVQ EDLSPGGDYI RLLLLPKSFS PEFRENWDEY       240
     RSEFWDKEND RRAQLRQKLR QRERQLVQQD GGWFWWFGLS WKASQRRRVA AATISRPGDA       300
     DKVQHRSHHH HHSSSISKLA LESKSPLRRG GPRSESHSRT PSRSTTPVDT DDRPPSRSSV       360
     SGRPRRGSTS PSTEQHIQQS RKKKASKAAT RGLSPLTQAQ IREGVRTPSF SSDDSSFMGT       420
     PSEKEKPKDE SVE                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page