(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE258

ASPNC_1.PE258        Location/Qualifiers
FT   CDS             join(complement(647435..648481),complement(646643..647362))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959929"
FT                   /orf_name="An01g02740"
FT                   /product="Catalytic activity: the A. oryzae tannase
FT                   converts digallate and H(2)O to 2 gallate. "
FT                   /EC_number="3.1.1.20"
FT                   /function="tannase activity"
FT                   /protein_id="CAK43641.1"
FT                   /db_xref="GO:0050318"
FT                   /db_xref="HOGENOM:HBG325297"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI0000EF9EFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q818"
FT                   /transl_table=1
FT                   /translation="MYSLAAATLVGVASAASLNSVCTTDYVTSVLPTASDDIPSGITID
FT                   TSSVSASIYRNYSLTDSIFWEDLTINFCEVSFAYSHQNGDDRVVVQYWMPSPDLFQNRF
FT                   LATGGSAYEINNGSGGGDIAGGVAFGAATGYTDGGFPYWGGTDFDDVVILGNGTANWPA
FT                   IYNWGYQAIAEMTQIGKAFTNNFFNVGNNVTKLYTYYIGCSEGGREGMSQAQRAPELYD
FT                   GIVAGAPAMRYGQQQVNHIAPPIQIQTIGYYPPSCVFDTVINATINACDGMDGKIDGVV
FT                   ARSDLCFQNFNVSSMLGKSYYCEAGSTTSLGLGYGKRSKRQTTSATPAQNGTINAKDIE
FT                   VIQDLLTGLKDSNGDLVYFPFQPTAGFGDTTVYDSTTDSWTITSPNSNGEWITKFLNWQ
FT                   NVTDLDMWGVTNDDLKAWMIEGMTKYMDSLQTTLPDLTPFHSKGGRLLHYHGEADSSVP
FT                   PTGSIHYHESVREIMYPDLSFAEGNEKLNDWYRFYLVPGAAHCATNDEQPNAGFPRDNF
FT                   AHMIKWVEEDVVPVRINATVTSGEHKGEVQELCTWPSRPYWTDNNTMVCEQNATSIQAM
FT                   LWKLSAYLTPVY"
     MYSLAAATLV GVASAASLNS VCTTDYVTSV LPTASDDIPS GITIDTSSVS ASIYRNYSLT        60
     DSIFWEDLTI NFCEVSFAYS HQNGDDRVVV QYWMPSPDLF QNRFLATGGS AYEINNGSGG       120
     GDIAGGVAFG AATGYTDGGF PYWGGTDFDD VVILGNGTAN WPAIYNWGYQ AIAEMTQIGK       180
     AFTNNFFNVG NNVTKLYTYY IGCSEGGREG MSQAQRAPEL YDGIVAGAPA MRYGQQQVNH       240
     IAPPIQIQTI GYYPPSCVFD TVINATINAC DGMDGKIDGV VARSDLCFQN FNVSSMLGKS       300
     YYCEAGSTTS LGLGYGKRSK RQTTSATPAQ NGTINAKDIE VIQDLLTGLK DSNGDLVYFP       360
     FQPTAGFGDT TVYDSTTDSW TITSPNSNGE WITKFLNWQN VTDLDMWGVT NDDLKAWMIE       420
     GMTKYMDSLQ TTLPDLTPFH SKGGRLLHYH GEADSSVPPT GSIHYHESVR EIMYPDLSFA       480
     EGNEKLNDWY RFYLVPGAAH CATNDEQPNA GFPRDNFAHM IKWVEEDVVP VRINATVTSG       540
     EHKGEVQELC TWPSRPYWTD NNTMVCEQNA TSIQAMLWKL SAYLTPVY                    588
//

If you have problems or comments...

PBIL Back to PBIL home page