(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE265

ASPNC_1.PE265        Location/Qualifiers
FT   CDS             join(665173..665272,665452..665661,665745..665779,
FT                   665860..665901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806679"
FT                   /orf_name="An01g02820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43648.1"
FT                   /db_xref="UniParc:UPI0000EF9F02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q825"
FT                   /transl_table=1
FT                   /translation="MVEAYGNLHSRIISDCAVSCFHDQVVVICSSPLSHFLETLGHATS
FT                   HTVGTYNGLLEVQVTRDRETGKLITTCEHRVLGSSQGTLFTSKIDLGALLYDRVGETHD
FT                   SVAIPGPAEIAQSADLAFEIIGSW"
     MVEAYGNLHS RIISDCAVSC FHDQVVVICS SPLSHFLETL GHATSHTVGT YNGLLEVQVT        60
     RDRETGKLIT TCEHRVLGSS QGTLFTSKID LGALLYDRVG ETHDSVAIPG PAEIAQSADL       120
     AFEIIGSW                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page