(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE266

ASPNC_1.PE266        Location/Qualifiers
FT   CDS             join(666258..666545,666601..666978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876804"
FT                   /orf_name="An01g02830"
FT                   /product="Similarity to heat shock protein 67B2 -Drosophila
FT                   melanogaster"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAK43649.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG329843"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI0000EF9F03"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q826"
FT                   /transl_table=1
FT                   /translation="MASLLPLRRAPTSLLSSTSKQSTLLVRSLRASTTIPSTRTFTTRS
FT                   STLLPNTITKRTTITPISRPHHHLLISSTSIRQKSTKDNDAPTFRQWGFEDINASLPNS
FT                   PTEKPIILIDVREPAELSSTGIIPSAVSVPLASQPDALFLTPEEFETRFGFPKPGVKGD
FT                   EEGAEIVFYCKAGVRARAAAQLAEQAGYEASRLGVYDGSWLDWAKKGGRVERWEGNDN"
     MASLLPLRRA PTSLLSSTSK QSTLLVRSLR ASTTIPSTRT FTTRSSTLLP NTITKRTTIT        60
     PISRPHHHLL ISSTSIRQKS TKDNDAPTFR QWGFEDINAS LPNSPTEKPI ILIDVREPAE       120
     LSSTGIIPSA VSVPLASQPD ALFLTPEEFE TRFGFPKPGV KGDEEGAEIV FYCKAGVRAR       180
     AAAQLAEQAG YEASRLGVYD GSWLDWAKKG GRVERWEGND N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page