(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE269

ASPNC_1.PE269        Location/Qualifiers
FT   CDS             join(676989..677238,677288..677419,677466..678352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876805"
FT                   /orf_name="An01g02860"
FT                   /product="Similarity to hypothetical protein SPBC651.03c -
FT                   Schizosaccharomyces pombe"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43652.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG329844"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0000EF9F28"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q829"
FT                   /transl_table=1
FT                   /translation="MDQPSENNEPDHITETSLETEQKTAAEAEALESERLKNAELERRR
FT                   AEKEKAIRQACDLRDFDALVSYATSEGGFLNDDVRRTAWPILLQCDRRGPNFDFAGWEQ
FT                   LPAHSDEEQVQLDVNRSFVYYPECSDQELSIKKDELSKLIKQVLRCFPMLCYFQGYHDI
FT                   VQVLLLVLGGQNSAAAVAQISLLRIRDYMLPSLSPALKHLELIPAIIEKADPALRRHLA
FT                   ETKPFFALAATLTMYSHDIQEYSDIARLFDFLLAQEPVVSIYLFAAIILSRKKELLEFS
FT                   VDETDMLHFTLSKLPNPLDLEGLISRAMQLFEAHPPESLPFGAWKRIPECSVLKSSRDL
FT                   VRIQAPDETVGLFAKQVRHLRYEERKEKTVAFLWNHRRTIGSVAVTIFIGAMSFWIKKR
FT                   GFDNTIWSYVSRFHGALQARGYI"
     MDQPSENNEP DHITETSLET EQKTAAEAEA LESERLKNAE LERRRAEKEK AIRQACDLRD        60
     FDALVSYATS EGGFLNDDVR RTAWPILLQC DRRGPNFDFA GWEQLPAHSD EEQVQLDVNR       120
     SFVYYPECSD QELSIKKDEL SKLIKQVLRC FPMLCYFQGY HDIVQVLLLV LGGQNSAAAV       180
     AQISLLRIRD YMLPSLSPAL KHLELIPAII EKADPALRRH LAETKPFFAL AATLTMYSHD       240
     IQEYSDIARL FDFLLAQEPV VSIYLFAAII LSRKKELLEF SVDETDMLHF TLSKLPNPLD       300
     LEGLISRAMQ LFEAHPPESL PFGAWKRIPE CSVLKSSRDL VRIQAPDETV GLFAKQVRHL       360
     RYEERKEKTV AFLWNHRRTI GSVAVTIFIG AMSFWIKKRG FDNTIWSYVS RFHGALQARG       420
     YI                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page