(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE274

ASPNC_1.PE274        Location/Qualifiers
FT   CDS             join(685681..686547,686600..686894,686949..687769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959931"
FT                   /orf_name="An01g02910"
FT                   /product="Similarity to hypothetical ARE1-like protein
FT                   F3I17.5 - Arabidopsis thaliana"
FT                   /protein_id="CAK43657.1"
FT                   /db_xref="HOGENOM:HBG323876"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI0000EF9F2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q834"
FT                   /transl_table=1
FT                   /translation="MWLDRISGHATPSGPQFDSRSSSPLPRRTSSRLAPTPQNNRPASS
FT                   RQGSALSLLSTPNDSSTSLSAPARGEGSSPKPSATRPRPSDVADPLEVLNGIIGKQGKT
FT                   RDSSPASVAELKPPELVEDIDFHGLSLEDFIAEEDQPRRAWQSDVGAQTIQQFEKERDK
FT                   FQDLHSAITGCDDVSKSVEMYLNDFQNELGAVSAEIESLQSRSIQLNAMLENRRNVEQL
FT                   LGPAVEEISLSPKTVRLVAEGPIDENWVKALNEIETRTASIEAKASGTNSSKSIEDVRP
FT                   LLGDIKKKAVERIRDYLVSQIRALRSPNINAQIIQQQRLVKFKDLYGYISRAHPTLTGE
FT                   ITQAYINTMRWYYLSHFTRYHQALEKIKVYPSDRNEVLGGDPTSHKTGNIVPGGRAGSA
FT                   AHDPFSLGRRVDILRAGNQMAISSYLAEEDNAFHGLEIPFRNFNLALLDNVSAEYSFMT
FT                   EMFSTLGFQQISRKAVEIFEPVFTLGQTLTKHLIEQTTDALGVLICVRLNQQAAFELQR
FT                   RKVPVADSYVNGTNMQLWPRFQVIMDTQCESLKRVAANTGRSAVSALSLAGGDDLNKSS
FT                   APHFLTQRFGQLLHGILVLSSEAGDDEPVSNSLGRLTTEFDNLLTKLSRIGGDAKRRER
FT                   FLYNNYSLVLAIISVSRSIRRGYWC"
     MWLDRISGHA TPSGPQFDSR SSSPLPRRTS SRLAPTPQNN RPASSRQGSA LSLLSTPNDS        60
     STSLSAPARG EGSSPKPSAT RPRPSDVADP LEVLNGIIGK QGKTRDSSPA SVAELKPPEL       120
     VEDIDFHGLS LEDFIAEEDQ PRRAWQSDVG AQTIQQFEKE RDKFQDLHSA ITGCDDVSKS       180
     VEMYLNDFQN ELGAVSAEIE SLQSRSIQLN AMLENRRNVE QLLGPAVEEI SLSPKTVRLV       240
     AEGPIDENWV KALNEIETRT ASIEAKASGT NSSKSIEDVR PLLGDIKKKA VERIRDYLVS       300
     QIRALRSPNI NAQIIQQQRL VKFKDLYGYI SRAHPTLTGE ITQAYINTMR WYYLSHFTRY       360
     HQALEKIKVY PSDRNEVLGG DPTSHKTGNI VPGGRAGSAA HDPFSLGRRV DILRAGNQMA       420
     ISSYLAEEDN AFHGLEIPFR NFNLALLDNV SAEYSFMTEM FSTLGFQQIS RKAVEIFEPV       480
     FTLGQTLTKH LIEQTTDALG VLICVRLNQQ AAFELQRRKV PVADSYVNGT NMQLWPRFQV       540
     IMDTQCESLK RVAANTGRSA VSALSLAGGD DLNKSSAPHF LTQRFGQLLH GILVLSSEAG       600
     DDEPVSNSLG RLTTEFDNLL TKLSRIGGDA KRRERFLYNN YSLVLAIISV SRSIRRGYWC       660
//

If you have problems or comments...

PBIL Back to PBIL home page