(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE275

ASPNC_1.PE275        Location/Qualifiers
FT   CDS             join(688177..688392,688472..688597,688674..689663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000245179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806682"
FT                   /orf_name="An01g02920"
FT                   /product="Similarity to hypothetical protein PA5145 -
FT                   Pseudomonas aeruginosa"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43658.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG525746"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EF9F2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q835"
FT                   /transl_table=1
FT                   /translation="MPTPPGVGNNHLSASPHPNNAPPYNAGIVTTIPLSHPVSMATRIL
FT                   RSLPNSRLLSRRAFSSTAASKADVTHAVIGAGVVGLAVARQLAMKEGTSTILLERHEAP
FT                   GTETSSRNSEVIHAGLYYGTDTLKTTLCIKGKELLYALCAQHNIPHRNTKKWIVAQTPE
FT                   QWEACLRVHEHAKRIGVPTRILGQDEARRREPEVRALAGIVESPTTGIIDSHSLMTYLQ
FT                   GDFEDRGGDCAFMTKVTGIEPVAASEGGGYRISAVSADGSETTITAETVINSAGNGACA
FT                   INNMVLPAERHRKAYFAKGTYFSYSASTPKTSVLVYPATLPGTGGLGTHLTLDMGGRIR
FT                   FGPDVEWVEDPNDLKPSPTRLQQALPEIRAYLPNVDVEAIDLDYCGIRPKLGKGGAVNT
FT                   GKGFHDFVIQEEEGFPGFVNLLGIESPGLTSCLAIGERVRDILY"
     MPTPPGVGNN HLSASPHPNN APPYNAGIVT TIPLSHPVSM ATRILRSLPN SRLLSRRAFS        60
     STAASKADVT HAVIGAGVVG LAVARQLAMK EGTSTILLER HEAPGTETSS RNSEVIHAGL       120
     YYGTDTLKTT LCIKGKELLY ALCAQHNIPH RNTKKWIVAQ TPEQWEACLR VHEHAKRIGV       180
     PTRILGQDEA RRREPEVRAL AGIVESPTTG IIDSHSLMTY LQGDFEDRGG DCAFMTKVTG       240
     IEPVAASEGG GYRISAVSAD GSETTITAET VINSAGNGAC AINNMVLPAE RHRKAYFAKG       300
     TYFSYSASTP KTSVLVYPAT LPGTGGLGTH LTLDMGGRIR FGPDVEWVED PNDLKPSPTR       360
     LQQALPEIRA YLPNVDVEAI DLDYCGIRPK LGKGGAVNTG KGFHDFVIQE EEGFPGFVNL       420
     LGIESPGLTS CLAIGERVRD ILY                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page