(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE276

ASPNC_1.PE276        Location/Qualifiers
FT   CDS             690505..691287
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654014"
FT                   /orf_name="An01g02930"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g09280 - Aspergillus niger"
FT                   /protein_id="CAK43659.1"
FT                   /db_xref="HOGENOM:HBG329847"
FT                   /db_xref="UniParc:UPI0000EF9F2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q836"
FT                   /transl_table=1
FT                   /translation="MTTHLQQPHHHNFHPHTSSYNPYHPYTIPNHAQTKKQRSRPHRRQ
FT                   RQHHPSTKPPNPSALKTPSSPSPSKSNRCFTWLLLPPASNTHIAKNRSSFSSYRRAPCK
FT                   IANQRVLGVGTVQLRVQRAPDDPRTNTLVLHDVLHMPNARCNGISVAKYTGESEEETAS
FT                   EGGSSAGERAVVEEVENGGLVKVKSEREDGEGLWFARGRSRGGQGKGEGGDDGLRVVLA
FT                   GEKEMEKDDGAGKGIMGVVASKEELEMLNERVKNRSWV"
     MTTHLQQPHH HNFHPHTSSY NPYHPYTIPN HAQTKKQRSR PHRRQRQHHP STKPPNPSAL        60
     KTPSSPSPSK SNRCFTWLLL PPASNTHIAK NRSSFSSYRR APCKIANQRV LGVGTVQLRV       120
     QRAPDDPRTN TLVLHDVLHM PNARCNGISV AKYTGESEEE TASEGGSSAG ERAVVEEVEN       180
     GGLVKVKSER EDGEGLWFAR GRSRGGQGKG EGGDDGLRVV LAGEKEMEKD DGAGKGIMGV       240
     VASKEELEML NERVKNRSWV                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page