(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE277

ASPNC_1.PE277        Location/Qualifiers
FT   CDS             join(complement(694162..694237),complement(694059..694113),
FT                   complement(692920..693991),complement(692751..692873),
FT                   complement(692655..692705),complement(692483..692607),
FT                   complement(691397..692438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959932"
FT                   /orf_name="An01g02940"
FT                   /product="Similarity is restricted to the C2H2-type zinc
FT                   finger motif"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43660.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG323877"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EF9F30"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q837"
FT                   /transl_table=1
FT                   /translation="MVLRKCTICDRRFKKTEHFKRHERSHTKEKPYECNVCHKRFSRSD
FT                   VLSRHARGHNQPAANAAVRPGAGLPATPTNQAPADRSSTMTADTQNYVLGIGAESARPL
FT                   QHGSSAPHNSAFSAALDQQSTSLDFLANVSAHQPRTEPIANQVMASEHQEYLGWNDVPV
FT                   PDQQCYRGTMLDPLHNDILQFWLEPQGDSISQQGSIDLGGNSNLGMLGGAVASSESRPS
FT                   IGSMSLSSGGSIPIERFARVQRYWLAPSNNTGRLMNSLWHDIAYSEEDNVFALRPTHSS
FT                   SGPSGYMQGSRYGVDEECRQRLYTIFSQSRGQFQMRSSESTAVSPFTQPPRNNSNFPPA
FT                   EILDMALDLFFRDFHPLVPFIHVPTFSAKDARPSLLYAMCLIGMVLLGTKGTLNFVVNN
FT                   FSSMLESVTADLSKCSVGVEGSLSTVSTFAAAFLFLNLAAMTGEKEHLVKCQMLYVNLI
FT                   SIAQRHGLFAAREGQVLGANLFDAIPNTETRWKAWSKVESVKRLITGLLLLDSWYSSFM
FT                   STSPIIVPDSVQMILPCEEALFRATSSTRWMQLSDSDKVRLMPTILMPSENVDVPTLHS
FT                   PVDDFCMYAVLAMVQSRLSEAYYRLLSNRASYPFAPCNTYAMDGRARCLPSLQLQLTSK
FT                   YGDVLDRLNPNAAVMWHNMCMTLTADTQIFDMAAGRSGPGPARKALDDIAAWSQTPAAR
FT                   RACLHAAHIYRAMTNRRASDHTMFHSVFSLFYAALVLGLYVFMVPNPSEMQRGGNSIEL
FT                   FDDIDWQKVGTEGFTSFMEPRKGQPFPPSEEPALEFIKNGGTVYLRGVPIQGGYQAARR
FT                   ILLDYAGLLKDTGKWSVRKFSYVLHIMSDVLMDVE"
     MVLRKCTICD RRFKKTEHFK RHERSHTKEK PYECNVCHKR FSRSDVLSRH ARGHNQPAAN        60
     AAVRPGAGLP ATPTNQAPAD RSSTMTADTQ NYVLGIGAES ARPLQHGSSA PHNSAFSAAL       120
     DQQSTSLDFL ANVSAHQPRT EPIANQVMAS EHQEYLGWND VPVPDQQCYR GTMLDPLHND       180
     ILQFWLEPQG DSISQQGSID LGGNSNLGML GGAVASSESR PSIGSMSLSS GGSIPIERFA       240
     RVQRYWLAPS NNTGRLMNSL WHDIAYSEED NVFALRPTHS SSGPSGYMQG SRYGVDEECR       300
     QRLYTIFSQS RGQFQMRSSE STAVSPFTQP PRNNSNFPPA EILDMALDLF FRDFHPLVPF       360
     IHVPTFSAKD ARPSLLYAMC LIGMVLLGTK GTLNFVVNNF SSMLESVTAD LSKCSVGVEG       420
     SLSTVSTFAA AFLFLNLAAM TGEKEHLVKC QMLYVNLISI AQRHGLFAAR EGQVLGANLF       480
     DAIPNTETRW KAWSKVESVK RLITGLLLLD SWYSSFMSTS PIIVPDSVQM ILPCEEALFR       540
     ATSSTRWMQL SDSDKVRLMP TILMPSENVD VPTLHSPVDD FCMYAVLAMV QSRLSEAYYR       600
     LLSNRASYPF APCNTYAMDG RARCLPSLQL QLTSKYGDVL DRLNPNAAVM WHNMCMTLTA       660
     DTQIFDMAAG RSGPGPARKA LDDIAAWSQT PAARRACLHA AHIYRAMTNR RASDHTMFHS       720
     VFSLFYAALV LGLYVFMVPN PSEMQRGGNS IELFDDIDWQ KVGTEGFTSF MEPRKGQPFP       780
     PSEEPALEFI KNGGTVYLRG VPIQGGYQAA RRILLDYAGL LKDTGKWSVR KFSYVLHIMS       840
     DVLMDVE                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page