(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE278

ASPNC_1.PE278        Location/Qualifiers
FT   CDS             join(complement(700631..701627),complement(700061..700563),
FT                   complement(699334..699985),complement(698623..699285),
FT                   complement(696265..698561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876807"
FT                   /orf_name="An01g02950"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43661.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG329848"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniParc:UPI0000EF9F31"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q838"
FT                   /transl_table=1
FT                   /translation="MMPTSPSKRDMRAHPHQNRKVPPRHDEYNVGWICVLPIEMAVAKL
FT                   MLDEIHPPLPMPPNDPNTYILGRVGDHNVVIACLPAGTYGSTTSVALERQVSSSFPAIR
FT                   FYLSVGIGGGIPSSKADIRLGDVVVSQPIGKSGGLIRYDLGKVLSWDESSHQVPEFLST
FT                   ALAALQVNHNLSGRMGGHVASYLSDMQEKLPPAAAEKFARPEEDFLFQPEYEHIGFDSC
FT                   ADCDRSKLILRRDREHEEPVIHYGSIASGPQVMKNGQLRDRIGQELGVLCFELEAAGLL
FT                   DNLPCLAIRGISDYADSHKNTAWQGYAAAAAAAYAKELLLVVPALEKKIHTASFSVRAM
FT                   SPSNQARSTDASGYSNPTPGWSRQKESTFNAPPTDSGYASTTHQKVLRGEEYRTEYVHD
FT                   VQSIVSGEERFSSPPAAASPRKAEDYSEDTESIYTARSGISPSDKESYISELVNDLFRK
FT                   VQYDQDAQNLPERIHGILPQLLKAFAMRFGQFGSTQIHRDIMYPDSEIANGLRVKYLED
FT                   QTETHVSRQDDTKMELGDLMDLWDQNLEDADDDLAIPQFDSGAENSDSDEDILIEDDEN
FT                   LPEYATYRKLITGSPVYEWLLRSLRRKLQLHPAEPNVQDAIRDRILKTLPSSRRVSRYD
FT                   QPTVYQVVYLLKWDPVSFIAEQEYDISKEGFLGKIITITGTSQDAQAMTCLQYLHQTWH
FT                   SYGANILQLVEAALVDERGYEHRCTLPDNTQLAAWANEKEFLVEVTGIEGSIAEIGEQL
FT                   AWLGSVLRCSPHDSRISYCTPFVSNTSVEEASIPTSQTPTLTRVSCTIDFKVDDQEQAN
FT                   SPPSLGQCWHDLFRYPTVAMGFPIPYRSREQTGLEIPLNILAGLAQAEQVDIFSDKLFI
FT                   KGFSSLLIPTKYIRDQDQMIWHLRYNVHGDRISYLDGIEAHVGHITLADLESSRHILGW
FT                   CSDAKCYAGTADASYSINRSWLRPPSSRCSLNNTFIAAGRLITGGDPAIYGNKDLPYRL
FT                   IRDEYIEKLSWIARQYVVMWDAGGKRGWLVNGACALLHLLIASLHFNRTGPLGFAFHLT
FT                   PTDIKVPENTITPSSAMEVLLNPDNLCLTLYHAKQSEPNEATLPTVQIKDRVDRLYSML
FT                   EKIMDHQAEIMGTEGAASRKMARGILEGWDFKDLATQEDPLYPRFCKLGTRGKSWVELT
FT                   RDVRAAVLFGTGFGEILRPVDNGQLCPYWSRMPEGKSYLAVSGYDLANIIDRFGNPHSS
FT                   PVRLTRNLIWCNCLGNGPPACKCIGCPEQTVHSELAQVVLPSHFRKRIPKHNAVRPSGW
FT                   SHGAILFGYNRDLRWTWNDTGFPEQEDVLSCSDDDSGSDSDDDFHDSGLGTILAPSATA
FT                   NGPGRLPLSRSPPEGITHEDYEVGIVCALSKELLAVRALFDSPHPDLEKDRNDPNCYCL
FT                   GRMKGFNVVAAGLPHDDYGTNSATNVASHLIRTFPRLKFCLVFGIGGGVPSAARDIRLG
FT                   DVVVGTGVIQGDMGKWIQNSEFKMTAQKQQPPPYLRAVITKIRSNGFISFESASNPLLD
FT                   DLSLIASMKPEYSYPGAGKDMLFDPGDVHVETEPTCDNCIGSRRPRTRQHDGPNVFYGL
FT                   IASGNQLVRDARYRDRLGQENVICVEMEAAGVMRTTTDCLVIRGICDYADSHKNDQWQE
FT                   YAAATAAAYAKFFLSHMREGVHEFAVRVPSRLEAPTGPVHLQKQKRAAPCAEYDQHMVL
FT                   KRSRWQ"
     MMPTSPSKRD MRAHPHQNRK VPPRHDEYNV GWICVLPIEM AVAKLMLDEI HPPLPMPPND        60
     PNTYILGRVG DHNVVIACLP AGTYGSTTSV ALERQVSSSF PAIRFYLSVG IGGGIPSSKA       120
     DIRLGDVVVS QPIGKSGGLI RYDLGKVLSW DESSHQVPEF LSTALAALQV NHNLSGRMGG       180
     HVASYLSDMQ EKLPPAAAEK FARPEEDFLF QPEYEHIGFD SCADCDRSKL ILRRDREHEE       240
     PVIHYGSIAS GPQVMKNGQL RDRIGQELGV LCFELEAAGL LDNLPCLAIR GISDYADSHK       300
     NTAWQGYAAA AAAAYAKELL LVVPALEKKI HTASFSVRAM SPSNQARSTD ASGYSNPTPG       360
     WSRQKESTFN APPTDSGYAS TTHQKVLRGE EYRTEYVHDV QSIVSGEERF SSPPAAASPR       420
     KAEDYSEDTE SIYTARSGIS PSDKESYISE LVNDLFRKVQ YDQDAQNLPE RIHGILPQLL       480
     KAFAMRFGQF GSTQIHRDIM YPDSEIANGL RVKYLEDQTE THVSRQDDTK MELGDLMDLW       540
     DQNLEDADDD LAIPQFDSGA ENSDSDEDIL IEDDENLPEY ATYRKLITGS PVYEWLLRSL       600
     RRKLQLHPAE PNVQDAIRDR ILKTLPSSRR VSRYDQPTVY QVVYLLKWDP VSFIAEQEYD       660
     ISKEGFLGKI ITITGTSQDA QAMTCLQYLH QTWHSYGANI LQLVEAALVD ERGYEHRCTL       720
     PDNTQLAAWA NEKEFLVEVT GIEGSIAEIG EQLAWLGSVL RCSPHDSRIS YCTPFVSNTS       780
     VEEASIPTSQ TPTLTRVSCT IDFKVDDQEQ ANSPPSLGQC WHDLFRYPTV AMGFPIPYRS       840
     REQTGLEIPL NILAGLAQAE QVDIFSDKLF IKGFSSLLIP TKYIRDQDQM IWHLRYNVHG       900
     DRISYLDGIE AHVGHITLAD LESSRHILGW CSDAKCYAGT ADASYSINRS WLRPPSSRCS       960
     LNNTFIAAGR LITGGDPAIY GNKDLPYRLI RDEYIEKLSW IARQYVVMWD AGGKRGWLVN      1020
     GACALLHLLI ASLHFNRTGP LGFAFHLTPT DIKVPENTIT PSSAMEVLLN PDNLCLTLYH      1080
     AKQSEPNEAT LPTVQIKDRV DRLYSMLEKI MDHQAEIMGT EGAASRKMAR GILEGWDFKD      1140
     LATQEDPLYP RFCKLGTRGK SWVELTRDVR AAVLFGTGFG EILRPVDNGQ LCPYWSRMPE      1200
     GKSYLAVSGY DLANIIDRFG NPHSSPVRLT RNLIWCNCLG NGPPACKCIG CPEQTVHSEL      1260
     AQVVLPSHFR KRIPKHNAVR PSGWSHGAIL FGYNRDLRWT WNDTGFPEQE DVLSCSDDDS      1320
     GSDSDDDFHD SGLGTILAPS ATANGPGRLP LSRSPPEGIT HEDYEVGIVC ALSKELLAVR      1380
     ALFDSPHPDL EKDRNDPNCY CLGRMKGFNV VAAGLPHDDY GTNSATNVAS HLIRTFPRLK      1440
     FCLVFGIGGG VPSAARDIRL GDVVVGTGVI QGDMGKWIQN SEFKMTAQKQ QPPPYLRAVI      1500
     TKIRSNGFIS FESASNPLLD DLSLIASMKP EYSYPGAGKD MLFDPGDVHV ETEPTCDNCI      1560
     GSRRPRTRQH DGPNVFYGLI ASGNQLVRDA RYRDRLGQEN VICVEMEAAG VMRTTTDCLV      1620
     IRGICDYADS HKNDQWQEYA AATAAAYAKF FLSHMREGVH EFAVRVPSRL EAPTGPVHLQ      1680
     KQKRAAPCAE YDQHMVLKRS RWQ                                              1703
//

If you have problems or comments...

PBIL Back to PBIL home page