(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE28

ASPNC_1.PE28         Location/Qualifiers
FT   CDS             join(71813..71815,71851..71936,72030..72094,72190..72239,
FT                   72480..72503,72727..73004,73067..73574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874693"
FT                   /orf_name="An01g00310"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An02g10090 - Aspergillus niger"
FT                   /protein_id="CAK43422.1"
FT                   /db_xref="UniParc:UPI0000EF9EF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D8"
FT                   /transl_table=1
FT                   /translation="MGNCIDMPSYPWISRGTKQRRNRANQETPSEVEGQNRTWHSLGGL
FT                   RGAVPGAGLVAKSTAVFTDLETAVQLSATTKEVESSSEDLSSVPFVPQPRSFLQAHPTI
FT                   SRLPFPNYIPLADRDEARENGWLVTDEENCSQEAAFFFTQWATANRVFHRPYSSLMDFC
FT                   GVHKMTPPSPFMSFATQIGWCPPTGRCWGIRLFLEPQSRNSAPLPHVAAVAYQPMNARD
FT                   GSILGGELVAILSIMHSRVKEPKVESEEVMEGLSDMNEQELEDLSKKSPAFPDEQKFPV
FT                   LLVSFVGPQHARLLCASLNTNLLVIHLSKLYSFEREQDAPLDLFMSWLFARPVAGA"
     MGNCIDMPSY PWISRGTKQR RNRANQETPS EVEGQNRTWH SLGGLRGAVP GAGLVAKSTA        60
     VFTDLETAVQ LSATTKEVES SSEDLSSVPF VPQPRSFLQA HPTISRLPFP NYIPLADRDE       120
     ARENGWLVTD EENCSQEAAF FFTQWATANR VFHRPYSSLM DFCGVHKMTP PSPFMSFATQ       180
     IGWCPPTGRC WGIRLFLEPQ SRNSAPLPHV AAVAYQPMNA RDGSILGGEL VAILSIMHSR       240
     VKEPKVESEE VMEGLSDMNE QELEDLSKKS PAFPDEQKFP VLLVSFVGPQ HARLLCASLN       300
     TNLLVIHLSK LYSFEREQDA PLDLFMSWLF ARPVAGA                                337
//

If you have problems or comments...

PBIL Back to PBIL home page